(data stored in ACNUC7421 zone)

EMBL: CP000478.PE21

CP000478.PE21        Location/Qualifiers
FT   CDS             complement(35199..35504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0022"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: protein of unknown function DUF77; KEGG:
FT                   mta:Moth_2497 protein of unknown function DUF77"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15725"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE73"
FT                   /protein_id="ABK15725.1"
FT                   /translation="MAVVEVSIVPIGVPGTSLSTHVAKVLKVLKESSLQYELTAMGTIV
FT                   SGDLDEILPVLKRMHESCFGPEVTRVLTQIRIDDRRDRKGTPEQKIRSVMDKLTDR"
     MAVVEVSIVP IGVPGTSLST HVAKVLKVLK ESSLQYELTA MGTIVSGDLD EILPVLKRMH        60
     ESCFGPEVTR VLTQIRIDDR RDRKGTPEQK IRSVMDKLTD R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page