(data stored in ACNUC7421 zone)

EMBL: CP000478.PE210

CP000478.PE210       Location/Qualifiers
FT   CDS             249092..251395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0213"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.6.2.2"
FT                   /note="KEGG: sat:SYN_02798 DNA topoisomerase I; TIGRFAM:
FT                   DNA topoisomerase I; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase, type IA, central domain protein; DNA
FT                   topoisomerase, type IA, zn finger domain protein; SMART:
FT                   DNA topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15914"
FT                   /db_xref="GOA:A0LER2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER2"
FT                   /protein_id="ABK15914.1"
FT                   /translation="MSKSLLIVESPTKAKTLGRYLGKDFIVKASVGHVKDLPKNRLGIN
FT                   LEKDFQPEYQVIRGKKKVISELHEAAAKSGAIFLGPDPDREGEAIAWHIAEEIGATDKP
FT                   VYRVLFYELTRKAIQEALAKPDRLNRELYEAQQARRILDRLVGYMISPILWQKVKRGLS
FT                   AGRVQSVALRLICAREKEIRDFDSREYWTITALLGTQASADAPAKSASRRFKAELFRCG
FT                   KKKCTISTGEEARELVDRLRPLDYRVSKVERRKKKRHPAPPFITSTLQQEAARKLHFSA
FT                   RQTMNVAQRLYEGLELGKEGAVGLITYMRTDSTRLSADAVQAVRDYIAGHWDKAYLPAK
FT                   PAAYKSKAGAQGAHEAIRPTDVNRTPETVAGFLTKEQLKLYTLIWKRFTACQMAPAVLD
FT                   QTSVDIAAGDYVLRASGSIVEFPGFMTLYVEGRENGDEDSETEGLLPELKEGEVLRLED
FT                   LKADQHFTQPPPRYTEASLIKELEDLGIGRPSTYATILSTILDREYAVVRKKSLFPSEL
FT                   GWLIDGLMVENFPSVVDVDFTAKMEKSLDEIEQGQHPYRNLLAEFYEQFSKTLESARTN
FT                   MVNLKAVGRRTDLQCPQCGLPLHIRWSRNGPFLACSGYPDCRFSSDYRRDEKGNIEPVA
FT                   EESTGETCEKCGRPMILKKGRFGNFLACSGYPACKNTKAPGTGIPCPREGCSGELVERV
FT                   SRGGRHFFGCSRYPECKTAFSGRPVPGKCPSCGTGPLIEKGGKGGSVKRVCVNPSCKYV
FT                   ETVPAAADRKAAKD"
     MSKSLLIVES PTKAKTLGRY LGKDFIVKAS VGHVKDLPKN RLGINLEKDF QPEYQVIRGK        60
     KKVISELHEA AAKSGAIFLG PDPDREGEAI AWHIAEEIGA TDKPVYRVLF YELTRKAIQE       120
     ALAKPDRLNR ELYEAQQARR ILDRLVGYMI SPILWQKVKR GLSAGRVQSV ALRLICAREK       180
     EIRDFDSREY WTITALLGTQ ASADAPAKSA SRRFKAELFR CGKKKCTIST GEEARELVDR       240
     LRPLDYRVSK VERRKKKRHP APPFITSTLQ QEAARKLHFS ARQTMNVAQR LYEGLELGKE       300
     GAVGLITYMR TDSTRLSADA VQAVRDYIAG HWDKAYLPAK PAAYKSKAGA QGAHEAIRPT       360
     DVNRTPETVA GFLTKEQLKL YTLIWKRFTA CQMAPAVLDQ TSVDIAAGDY VLRASGSIVE       420
     FPGFMTLYVE GRENGDEDSE TEGLLPELKE GEVLRLEDLK ADQHFTQPPP RYTEASLIKE       480
     LEDLGIGRPS TYATILSTIL DREYAVVRKK SLFPSELGWL IDGLMVENFP SVVDVDFTAK       540
     MEKSLDEIEQ GQHPYRNLLA EFYEQFSKTL ESARTNMVNL KAVGRRTDLQ CPQCGLPLHI       600
     RWSRNGPFLA CSGYPDCRFS SDYRRDEKGN IEPVAEESTG ETCEKCGRPM ILKKGRFGNF       660
     LACSGYPACK NTKAPGTGIP CPREGCSGEL VERVSRGGRH FFGCSRYPEC KTAFSGRPVP       720
     GKCPSCGTGP LIEKGGKGGS VKRVCVNPSC KYVETVPAAA DRKAAKD                     767
//

If you have problems or comments...

PBIL Back to PBIL home page