(data stored in ACNUC7421 zone)

EMBL: CP000478.PE213

CP000478.PE213       Location/Qualifiers
FT   CDS             252991..253632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15917"
FT                   /db_xref="UniProtKB/TrEMBL:A0LER5"
FT                   /protein_id="ABK15917.1"
FT                   /translation="MRCSKCGFVSFDHQSECKGCGASLAAVRDELGLPHVKSALPFTLG
FT                   SLTKEIDTKQTEVKGLVLDEPYDSTLPDIEFDDEYQGGSKPSAEQAPAPPSGGAARVSM
FT                   EDLISRSDAGADKEDSFSLDLDFLQTEEPTSRAQAPAASAVDAGAGKGNVGRYMPQAAP
FT                   SPAAPAKPSGTADDSLVIELSDSDLENILEDLKDVPPDPPHPGKGRAKIS"
     MRCSKCGFVS FDHQSECKGC GASLAAVRDE LGLPHVKSAL PFTLGSLTKE IDTKQTEVKG        60
     LVLDEPYDST LPDIEFDDEY QGGSKPSAEQ APAPPSGGAA RVSMEDLISR SDAGADKEDS       120
     FSLDLDFLQT EEPTSRAQAP AASAVDAGAG KGNVGRYMPQ AAPSPAAPAK PSGTADDSLV       180
     IELSDSDLEN ILEDLKDVPP DPPHPGKGRA KIS                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page