(data stored in ACNUC7421 zone)

EMBL: CP000478.PE218

CP000478.PE218       Location/Qualifiers
FT   CDS             261500..263107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gll0640 similar to
FT                   glucosamine-6-sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15922"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES0"
FT                   /protein_id="ABK15922.1"
FT                   /translation="MTKPRNNEDGLLAAHLAKRLTAYSAAAGLVLAMSPQAESAIHWFH
FT                   PSTPFEVDHSHTKTIDMDNDGTGDISFGLQPMGKTFWSLAVNRKNAAGRFDGTGRLVRR
FT                   LEKGSMVTPSLDADAAVLMNERYFTTCYPANGTNTSIICRWWTVWGDGAFNKEAKGYVG
FT                   VKFRGGSGKDYNGWVHFTGGNDPADLSGTIDEWAYEDSGGAIKAGAVTSQAAHAFLSDL
FT                   SGNGSPELALLQVTQGSSFGGSVLIRDIATGDEIRQVQCLGPLFRPVSMARISNVDGNG
FT                   NPALAILGVRENAAKEILAVRVELRNPASGELIRNIGFSKGCRPVALRWLNRDMNGSGV
FT                   GELAVLGTHPDGGRSMVEIRDLLTGALVKRITVGPDSTVESIGLSYSNDLNGNGSQELV
FT                   VLQRKAATQVSHLKVVDTGTGRTIKTIPCLSESWIPVDIASIGDLNGNGSLEQGVLARS
FT                   ATGEKVVVKIMDLRAGKALRNVSFNSAFLPQKLAAGDINGDGVYDLGVLGINLLDATTG
FT                   IEIRDPVTRSLIKTILIP"
     MTKPRNNEDG LLAAHLAKRL TAYSAAAGLV LAMSPQAESA IHWFHPSTPF EVDHSHTKTI        60
     DMDNDGTGDI SFGLQPMGKT FWSLAVNRKN AAGRFDGTGR LVRRLEKGSM VTPSLDADAA       120
     VLMNERYFTT CYPANGTNTS IICRWWTVWG DGAFNKEAKG YVGVKFRGGS GKDYNGWVHF       180
     TGGNDPADLS GTIDEWAYED SGGAIKAGAV TSQAAHAFLS DLSGNGSPEL ALLQVTQGSS       240
     FGGSVLIRDI ATGDEIRQVQ CLGPLFRPVS MARISNVDGN GNPALAILGV RENAAKEILA       300
     VRVELRNPAS GELIRNIGFS KGCRPVALRW LNRDMNGSGV GELAVLGTHP DGGRSMVEIR       360
     DLLTGALVKR ITVGPDSTVE SIGLSYSNDL NGNGSQELVV LQRKAATQVS HLKVVDTGTG       420
     RTIKTIPCLS ESWIPVDIAS IGDLNGNGSL EQGVLARSAT GEKVVVKIMD LRAGKALRNV       480
     SFNSAFLPQK LAAGDINGDG VYDLGVLGIN LLDATTGIEI RDPVTRSLIK TILIP            535
//

If you have problems or comments...

PBIL Back to PBIL home page