(data stored in ACNUC7421 zone)

EMBL: CP000478.PE220

CP000478.PE220       Location/Qualifiers
FT   CDS             265672..266172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0223"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: sat:SYN_02087 hypothetical cytosolic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15924"
FT                   /db_xref="GOA:A0LES2"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES2"
FT                   /protein_id="ABK15924.1"
FT                   /translation="METWSQRDRPVLDIHSHQTGKDPVIEVMKDILRENDMCVLATCAD
FT                   NRPHCSLMAYVTDEAAQTVYMVTLKSTRKYRHVCENPHVSLLVDTRHKSATDRGGTRAL
FT                   TVHGTFHPLSDAAAKEKILAAIRGRHPHLRKLVDDADAEVLAVRVESLQLLEGAYRASY
FT                   ESL"
     METWSQRDRP VLDIHSHQTG KDPVIEVMKD ILRENDMCVL ATCADNRPHC SLMAYVTDEA        60
     AQTVYMVTLK STRKYRHVCE NPHVSLLVDT RHKSATDRGG TRALTVHGTF HPLSDAAAKE       120
     KILAAIRGRH PHLRKLVDDA DAEVLAVRVE SLQLLEGAYR ASYESL                      166
//

If you have problems or comments...

PBIL Back to PBIL home page