(data stored in ACNUC7421 zone)

EMBL: CP000478.PE221

CP000478.PE221       Location/Qualifiers
FT   CDS             266567..267211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cya:CYA_2713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15925"
FT                   /db_xref="GOA:A0LES3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES3"
FT                   /protein_id="ABK15925.1"
FT                   /translation="MLFSRMDEEDDRVFYERDRLVAHLDSVALRTVESLIGRLVTGPKP
FT                   AILDLMASWDSHIPDSVQPSKVVGLGLNRNELAHNRTLTEFILHDLNRNPELPFDDDTF
FT                   DAVINTVSVDYMTRPFEVFAQVGRILKRGGLFLVVFSNRFFPQKATKLWRDSKEGARVV
FT                   LVKDFFRSVPVFDFPEDFLSAGKPRPKDDKYAHLGIPSDPIYAVYARKKES"
     MLFSRMDEED DRVFYERDRL VAHLDSVALR TVESLIGRLV TGPKPAILDL MASWDSHIPD        60
     SVQPSKVVGL GLNRNELAHN RTLTEFILHD LNRNPELPFD DDTFDAVINT VSVDYMTRPF       120
     EVFAQVGRIL KRGGLFLVVF SNRFFPQKAT KLWRDSKEGA RVVLVKDFFR SVPVFDFPED       180
     FLSAGKPRPK DDKYAHLGIP SDPIYAVYAR KKES                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page