(data stored in ACNUC7421 zone)

EMBL: CP000478.PE223

CP000478.PE223       Location/Qualifiers
FT   CDS             complement(267812..268279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0226"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="PFAM: transcription elongation factor GreA/GreB
FT                   domain protein; KEGG: sat:SYN_00542 transcription
FT                   elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15927"
FT                   /db_xref="GOA:A0LES5"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES5"
FT                   /protein_id="ABK15927.1"
FT                   /translation="MKVPITRLGYHRLLRELFFLRHVVRPEVIEELQEARTGGIKIENQ
FT                   QYMLARERHMVLQKKIQDLERKLASCEIVVGRKFFFKQAEFGTIVVIQNIETGETQRYQ
FT                   LVGPYESNVVDGKLSIDSPVGRHLVGRREGEEVLVYTPAGVRMYRVVSITL"
     MKVPITRLGY HRLLRELFFL RHVVRPEVIE ELQEARTGGI KIENQQYMLA RERHMVLQKK        60
     IQDLERKLAS CEIVVGRKFF FKQAEFGTIV VIQNIETGET QRYQLVGPYE SNVVDGKLSI       120
     DSPVGRHLVG RREGEEVLVY TPAGVRMYRV VSITL                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page