(data stored in ACNUC7421 zone)

EMBL: CP000478.PE226

CP000478.PE226       Location/Qualifiers
FT   CDS             269699..270307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0229"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: pai:PAE2336 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15930"
FT                   /db_xref="GOA:A0LES8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0LES8"
FT                   /protein_id="ABK15930.1"
FT                   /translation="MAEKKMQPIKLSHPRTRGSVSIEEALLKRRSVRSYTGVPLSIEDL
FT                   SQLLWAAQGMSHPRGYRTAPSAGALYPLELLVAAGRVGALSPGVYRYDPHRHEIVLHRE
FT                   GDRRANLRRASLDQSAVGNAPAVLIFCAVYERTTRKYGERGVRYAMMEAGHAAQNVHLQ
FT                   VVSLGLGTVLIGAFRDDQVKSVLELGGNEEPLYLMPVGK"
     MAEKKMQPIK LSHPRTRGSV SIEEALLKRR SVRSYTGVPL SIEDLSQLLW AAQGMSHPRG        60
     YRTAPSAGAL YPLELLVAAG RVGALSPGVY RYDPHRHEIV LHREGDRRAN LRRASLDQSA       120
     VGNAPAVLIF CAVYERTTRK YGERGVRYAM MEAGHAAQNV HLQVVSLGLG TVLIGAFRDD       180
     QVKSVLELGG NEEPLYLMPV GK                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page