(data stored in ACNUC7421 zone)

EMBL: CP000478.PE228

CP000478.PE228       Location/Qualifiers
FT   CDS             271546..274056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0231"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="KEGG: gsu:GSU1529 sensory box histidine
FT                   kinase/response regulator; TIGRFAM: PAS sensor protein;
FT                   PFAM: response regulator receiver; ATP-binding region,
FT                   ATPase domain protein domain protein; histidine kinase A
FT                   domain protein domain protein; PAS fold-3 domain protein;
FT                   PAS fold-4 domain protein; SMART: PAS domain containing
FT                   protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15932"
FT                   /db_xref="GOA:A0LET0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET0"
FT                   /protein_id="ABK15932.1"
FT                   /translation="MPAWAFRFMPVLTKRSFTDKVQTSVALFRTMKNDTPGGPQWIAPS
FT                   LEGNAVKVSMESPEDAMSECSSLRERVRELESAENPFRTALEDHDELIVRFRPDFTLVY
FT                   ANQAYCRHLADTEAPCVGGNFLDCVNPADHDRVREEIGSLVPDGPVKTVEHGVLLGGRE
FT                   VRLSRWVYRAMIGERTDVIEYLGMSCVQGERIAHPGPWNEYRFLAEKTGNAAYRLRCDS
FT                   RTYDHLGPAITRLTGYPLDEFDVSKFSELIEKIEIPGEEDVTPDTLIGFRKEGRTGEYR
FT                   ADYLIRTRLGERKWVRDHSFPWYDESGGLVGSVGILSDVTECKRAEEALQESEERFRNM
FT                   AGLSPFPIAIVDRNGKIIYLNQRFVDLFGYTASDIPTLWDWFNQACPDPGESRTIIERI
FT                   RSDLQAASKYEVISHEHRVRCKDGSSREIRFRLVSMENGDKFVTCEDLTEHMKIQEERI
FT                   KASKLESIGVLAGGIAHDFNNILTAIIGNISLAKLYGGQGGRVSEKLTEAERACMRAKN
FT                   LTQQLLTFSKGGEPIKKVIDVSDFLHEAVHFVLTGSNVRSVFFLPDDLWPVQCDEGQMG
FT                   QVINNLIINAKQAMPDGGTIEISAENVILNAGDQALPLKPGRYLRIGVKDYGHGIPEEA
FT                   LTRIFDPYFTTKLKGSGLGLATAYSIIKKHEGYIQVESRVGEGAAFHIYLPVAGWSLRE
FT                   HDKMGDDTLRGRGRVLVMDDEDIILNCTYDLLRYLGYEVELARDGAEAVELYQEAVGLS
FT                   RPFDAVIMDLTVPGGVGGVEAMQRLREIDPKVNAIVSSGYSNDPIMSQYREYGFRGVIT
FT                   KPYKLEQIGELLKTIVRRKWDAVE"
     MPAWAFRFMP VLTKRSFTDK VQTSVALFRT MKNDTPGGPQ WIAPSLEGNA VKVSMESPED        60
     AMSECSSLRE RVRELESAEN PFRTALEDHD ELIVRFRPDF TLVYANQAYC RHLADTEAPC       120
     VGGNFLDCVN PADHDRVREE IGSLVPDGPV KTVEHGVLLG GREVRLSRWV YRAMIGERTD       180
     VIEYLGMSCV QGERIAHPGP WNEYRFLAEK TGNAAYRLRC DSRTYDHLGP AITRLTGYPL       240
     DEFDVSKFSE LIEKIEIPGE EDVTPDTLIG FRKEGRTGEY RADYLIRTRL GERKWVRDHS       300
     FPWYDESGGL VGSVGILSDV TECKRAEEAL QESEERFRNM AGLSPFPIAI VDRNGKIIYL       360
     NQRFVDLFGY TASDIPTLWD WFNQACPDPG ESRTIIERIR SDLQAASKYE VISHEHRVRC       420
     KDGSSREIRF RLVSMENGDK FVTCEDLTEH MKIQEERIKA SKLESIGVLA GGIAHDFNNI       480
     LTAIIGNISL AKLYGGQGGR VSEKLTEAER ACMRAKNLTQ QLLTFSKGGE PIKKVIDVSD       540
     FLHEAVHFVL TGSNVRSVFF LPDDLWPVQC DEGQMGQVIN NLIINAKQAM PDGGTIEISA       600
     ENVILNAGDQ ALPLKPGRYL RIGVKDYGHG IPEEALTRIF DPYFTTKLKG SGLGLATAYS       660
     IIKKHEGYIQ VESRVGEGAA FHIYLPVAGW SLREHDKMGD DTLRGRGRVL VMDDEDIILN       720
     CTYDLLRYLG YEVELARDGA EAVELYQEAV GLSRPFDAVI MDLTVPGGVG GVEAMQRLRE       780
     IDPKVNAIVS SGYSNDPIMS QYREYGFRGV ITKPYKLEQI GELLKTIVRR KWDAVE           836
//

If you have problems or comments...

PBIL Back to PBIL home page