(data stored in ACNUC7421 zone)

EMBL: CP000478.PE229

CP000478.PE229       Location/Qualifiers
FT   CDS             complement(274155..274583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0232"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: mta:Moth_0402
FT                   phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15933"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET1"
FT                   /protein_id="ABK15933.1"
FT                   /translation="MMDEAVREAIVRRMSEEPFANKLGIRLVAIEAGYSKVRMEVTSEM
FT                   ENLCGMAHGGAVFALADAAFETASNSHGTVAVALSMTITYLAASSAGAVLVAEATEVNR
FT                   TRKTACYDIRVHDGDEKLIAMCQATVYRKETPLPYLGV"
     MMDEAVREAI VRRMSEEPFA NKLGIRLVAI EAGYSKVRME VTSEMENLCG MAHGGAVFAL        60
     ADAAFETASN SHGTVAVALS MTITYLAASS AGAVLVAEAT EVNRTRKTAC YDIRVHDGDE       120
     KLIAMCQATV YRKETPLPYL GV                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page