(data stored in ACNUC7421 zone)

EMBL: CP000478.PE230

CP000478.PE230       Location/Qualifiers
FT   CDS             274640..274924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15934"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET2"
FT                   /protein_id="ABK15934.1"
FT                   /translation="MPMMSRAVPHHRTDRASPSYRMGSLSQPILPAGGSGVNFHRTNDV
FT                   CAARPGGSTATLPGKGAPVIPVQCMSREVPSLRRIGSVPRRVFWLAKDS"
     MPMMSRAVPH HRTDRASPSY RMGSLSQPIL PAGGSGVNFH RTNDVCAARP GGSTATLPGK        60
     GAPVIPVQCM SREVPSLRRI GSVPRRVFWL AKDS                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page