(data stored in ACNUC7421 zone)

EMBL: CP000478.PE233

CP000478.PE233       Location/Qualifiers
FT   CDS             276536..277189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0236"
FT                   /product="protein of unknown function DUF1121"
FT                   /note="PFAM: protein of unknown function DUF1121; KEGG:
FT                   dde:Dde_2335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15937"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET5"
FT                   /protein_id="ABK15937.1"
FT                   /translation="MDKPFDHYWQLRLSDLKETLEANNFEVFLADNKEQACKLVLERII
FT                   PGIGAKSVSWGGSMTFVATGLYEKVKALPGLEVIDTYDRSIPREEATERRRRALLVDLY
FT                   ITGTNAVTETGKLVNLDMTGNRVASIIFGPRNVILLIGRNKVVPDLEDAMLRVKNFTAP
FT                   VNAMRLDMQTPCVSTSFCEECKSPSRICNTWTITEKSFPKGRIKIVLINEDLGI"
     MDKPFDHYWQ LRLSDLKETL EANNFEVFLA DNKEQACKLV LERIIPGIGA KSVSWGGSMT        60
     FVATGLYEKV KALPGLEVID TYDRSIPREE ATERRRRALL VDLYITGTNA VTETGKLVNL       120
     DMTGNRVASI IFGPRNVILL IGRNKVVPDL EDAMLRVKNF TAPVNAMRLD MQTPCVSTSF       180
     CEECKSPSRI CNTWTITEKS FPKGRIKIVL INEDLGI                                217
//

If you have problems or comments...

PBIL Back to PBIL home page