(data stored in ACNUC7421 zone)

EMBL: CP000478.PE236

CP000478.PE236       Location/Qualifiers
FT   CDS             279792..280568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0239"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   tbd:Tbd_1473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15940"
FT                   /db_xref="GOA:A0LET8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0LET8"
FT                   /protein_id="ABK15940.1"
FT                   /translation="MTMQPYSESRPNEASFTVASYNTHRCVGIDRKYDPERTARVIREL
FT                   DADIIGLQEIDAGFYRSQGSRQLERLADATGLNVVNGPTKRGTGGHYGNVLLTSRKVVG
FT                   VRRIDLSVYGREPRGAIDVDLDVDGEIVRVMVVHLGLGGLERRRQVNRLLHGCSSEQEQ
FT                   LHVVLGDINEWFPLGRPLHRLHRHFGKSPARRTFPSFLPVLALDRIWVKPLDALMEISV
FT                   HDTVLSRVASDHLPIKATITRMDATAACAGSLSGVK"
     MTMQPYSESR PNEASFTVAS YNTHRCVGID RKYDPERTAR VIRELDADII GLQEIDAGFY        60
     RSQGSRQLER LADATGLNVV NGPTKRGTGG HYGNVLLTSR KVVGVRRIDL SVYGREPRGA       120
     IDVDLDVDGE IVRVMVVHLG LGGLERRRQV NRLLHGCSSE QEQLHVVLGD INEWFPLGRP       180
     LHRLHRHFGK SPARRTFPSF LPVLALDRIW VKPLDALMEI SVHDTVLSRV ASDHLPIKAT       240
     ITRMDATAAC AGSLSGVK                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page