(data stored in ACNUC7421 zone)

EMBL: CP000478.PE244

CP000478.PE244       Location/Qualifiers
FT   CDS             complement(288481..289383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15948"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU6"
FT                   /protein_id="ABK15948.1"
FT                   /translation="MRFSKGYDRKPELLPARPGTATSPRSRTSFLLLVSFLLFTCVFPA
FT                   WASDEKDPWKVLDEGLGVAEFSSSSSDELEYRITVVRIDPRYYAFKLINASENTREKMT
FT                   AREWSRQFNLIAAVNAGMYQEDGLASVGYMKNFDHVNNPRLGRDKTVLAFNPSGPDVPE
FT                   VQIIDRECQDFNSLRQKYRTFVQSIRMISCDRKNVWRQQAGRWSTVAIGTDETGKVLLL
FT                   FCRSPITVHDFIEVLLTLPLSLQRAMYLEGGPQASLYLSTGKTTLERYGSWEPALEQNS
FT                   SIQIPLPVPNVIGIVKKTP"
     MRFSKGYDRK PELLPARPGT ATSPRSRTSF LLLVSFLLFT CVFPAWASDE KDPWKVLDEG        60
     LGVAEFSSSS SDELEYRITV VRIDPRYYAF KLINASENTR EKMTAREWSR QFNLIAAVNA       120
     GMYQEDGLAS VGYMKNFDHV NNPRLGRDKT VLAFNPSGPD VPEVQIIDRE CQDFNSLRQK       180
     YRTFVQSIRM ISCDRKNVWR QQAGRWSTVA IGTDETGKVL LLFCRSPITV HDFIEVLLTL       240
     PLSLQRAMYL EGGPQASLYL STGKTTLERY GSWEPALEQN SSIQIPLPVP NVIGIVKKTP       300
//

If you have problems or comments...

PBIL Back to PBIL home page