(data stored in ACNUC7421 zone)

EMBL: CP000478.PE247

CP000478.PE247       Location/Qualifiers
FT   CDS             complement(292505..294484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP1756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15951"
FT                   /db_xref="GOA:A0LEU9"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEU9"
FT                   /protein_id="ABK15951.1"
FT                   /translation="MRELRIRFPALAFGLVLVLLCCVFTPYNNIRLQNSPVAGGHFPLA
FT                   SFVCLFIILVVVNPALGAINRKWRFHYHELLLIWAMVTVATGIAYTGLMRTFIINITSP
FT                   TWLKLSSGETGQLLQSFLPSALFPNDPEMVRTLYSGFSGGIDMTWWQVLSRIPWSAWLT
FT                   PMFWWAIFIGLVYMAMLGMVGLFSHQWIENEKMNFPLLRVPEVLSQEAEDKTLRRFLTH
FT                   RYFIVGLTIPVLLHLLNGLHTYFPQVPQIPTLVLAQPYIPKEGLLSGFYKMKIYIYPAF
FT                   IGFAFLASKQVSFSLWSFFILGGLLPGILKLVGWRFPAAALGTTFGPVLSKVEEMQMIG
FT                   AFGMYFFFLLWLSRQHLLAVLKSAFSRSRETPEYCGLMSPRPALYLFFIGIVGITAWLT
FT                   FFGMSLLSAILFLAVCFMLQLVASRLICQGGLPYFTLTLAPSDGFLAFLDTRLIGPATL
FT                   GMAVILQKVTFLDMRESLMPSICHASKLSDGSRPRNRFLWGIVWAIALGMVVSFAAMLA
FT                   LYYRYGVNALPDDWAIESTRRVHENVTHLFSHPEEPKSWSIAFTLIGAAFMGLLVMGYH
FT                   RFIWWPLHPIGYLVTYSSAMQILWFGFFIGWLCNTLVLRYGGANLYREIRRLFIGLIVG
FT                   DMIMAVIWLIVGLFTPISYHVLPL"
     MRELRIRFPA LAFGLVLVLL CCVFTPYNNI RLQNSPVAGG HFPLASFVCL FIILVVVNPA        60
     LGAINRKWRF HYHELLLIWA MVTVATGIAY TGLMRTFIIN ITSPTWLKLS SGETGQLLQS       120
     FLPSALFPND PEMVRTLYSG FSGGIDMTWW QVLSRIPWSA WLTPMFWWAI FIGLVYMAML       180
     GMVGLFSHQW IENEKMNFPL LRVPEVLSQE AEDKTLRRFL THRYFIVGLT IPVLLHLLNG       240
     LHTYFPQVPQ IPTLVLAQPY IPKEGLLSGF YKMKIYIYPA FIGFAFLASK QVSFSLWSFF       300
     ILGGLLPGIL KLVGWRFPAA ALGTTFGPVL SKVEEMQMIG AFGMYFFFLL WLSRQHLLAV       360
     LKSAFSRSRE TPEYCGLMSP RPALYLFFIG IVGITAWLTF FGMSLLSAIL FLAVCFMLQL       420
     VASRLICQGG LPYFTLTLAP SDGFLAFLDT RLIGPATLGM AVILQKVTFL DMRESLMPSI       480
     CHASKLSDGS RPRNRFLWGI VWAIALGMVV SFAAMLALYY RYGVNALPDD WAIESTRRVH       540
     ENVTHLFSHP EEPKSWSIAF TLIGAAFMGL LVMGYHRFIW WPLHPIGYLV TYSSAMQILW       600
     FGFFIGWLCN TLVLRYGGAN LYREIRRLFI GLIVGDMIMA VIWLIVGLFT PISYHVLPL        659
//

If you have problems or comments...

PBIL Back to PBIL home page