(data stored in ACNUC7421 zone)

EMBL: CP000478.PE248

CP000478.PE248       Location/Qualifiers
FT   CDS             complement(294563..299332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0251"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   dps:DP1755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15952"
FT                   /db_xref="GOA:A0LEV0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV0"
FT                   /protein_id="ABK15952.1"
FT                   /translation="MPTDAKTRSGFNRAARIVLLAWLTACPLWSGLFPGVGYGREVMDH
FT                   VAFFTDLKDRSAGSPGSDAAADYILDFFKKAGLSEVASQQFLTPVPEVVSASIEAEGRT
FT                   VNLYPWGPNLVYLPMTPENGLRGQLIYAGRGDFKDFDRTRLYESIVLMDMESSGNWINA
FT                   ASFGAAAIVFIGRDDSVKGQFEEKDTRTPLTIPRFWVPAGDGEALKRLAMEKTPQAVVK
FT                   SKTRWQNKLVRNCYGLLKGSDPKLRKEMVVVDAAYDASFRVLGLAPGADEATSVAALLI
FT                   LAEEFSRHPPARSVLFVATVGNNESHDGMRHLIWSVKTKKKSLKKLTNQLKDTKARIDD
FT                   QYDLLEKGRYLEQEKPADRESILEILVEKAKDRADALSREIQYRRSASALELAEAQEGP
FT                   RAYRQIAMVNDIGRLTAQQRELAVQLLDEAVEDRRATHKELKVRVQAMKSSTALRGLLE
FT                   EYTQVLFFDLHLSSHYETLGLIETGETFPVRESIRKISRAGRLIGLFTQSGRETAAETG
FT                   IPDIFRDTSRGASPEEISVRAGSVCHPASDVASIAGLPAVSLVSLEDRRLLWSTPADTL
FT                   DRMDRKKVETLSGFLPPALRRLFSEPSLKSAVDAGVSGLSNLEGQAMFIRQGELFPDQP
FT                   ASGTIISILQGDSVFRTMVLRDGTYFMPGLANKRVSLEKLILEPYGIDPATGRIGIAAD
FT                   KAKTGKENYRISVKSDLASAPLIMFRCLQTDILPIFNPRNMGYLTKLELIDAATEAPPL
FT                   RHWYSRVDGRDTMSISLFLEKGTRFKLIMSESLLGKEFFLLNGIPENPNGIGFLVGEPP
FT                   TVSVAPYHVAKDLYSLVGGRLRNLFQHGIVNVHLEELYRQAGTELEQGILALSEHRYGD
FT                   FWDRVATAWAKLDIVYAEVEGNQRDVLGGVMFFIALFVPFAYCMERYIFCFRGIYQQIV
FT                   AFFLILIMTILAIRGLHPAFQLTYSPMVVIIAFFIVGLSLLVSAIIFIRFEKEMEDLQT
FT                   RQAHLRTPQASKWQAFGAGFSIGVSNLNRRKLRTGLTCVTLIILTFTVMSFTNVKSLHR
FT                   STLTRIAEDNPYEGVLLRHQFRLPMTMLTLEDMKARFGPEGASIWPRGWIEPAGLTERT
FT                   ISAVYASGRHAPVEGLLGLGPSAPEVFTRLVTKGRWLNETDDRAVLLPLAMAARLGLDP
FT                   ERDLNVPVEIMGARFTVVGFFDGSALDEAKDLDRHPITPAYLEVSHGEELSEVEIEAMQ
FT                   TGEELLPQTERFRYAAGNRTVIMPFAKCVEYGGKLKAVSILPRSSPTEIADRLSTWLAY
FT                   PLFVGENGTWYHSASTTLRYSGVANLLVPILIVIFITLNTMIGHVHERQKEISTYTSVG
FT                   LAPTHVGFLFIVEALSLAVISTVLGYILAQLSAKYLGNTAMFSQLTFNYSSLASVACMF
FT                   LVFSVVFLAALYPARLAAQIAMPDVNRSWTLPAPEGDVIHMNLPFLLKAEEEAGIMKFL
FT                   KAFYGSHQDVAHGSFIVDEIDMDDALPPVRPGQNPIPVCIVIRTNAWLAPFDFAIKQRV
FT                   HLHCCPSEENPGYLEIAIQMTRISGERSAWVRANNSFIKALRKQMLLWRLLDADTKAIY
FT                   YLPEQSETAG"
     MPTDAKTRSG FNRAARIVLL AWLTACPLWS GLFPGVGYGR EVMDHVAFFT DLKDRSAGSP        60
     GSDAAADYIL DFFKKAGLSE VASQQFLTPV PEVVSASIEA EGRTVNLYPW GPNLVYLPMT       120
     PENGLRGQLI YAGRGDFKDF DRTRLYESIV LMDMESSGNW INAASFGAAA IVFIGRDDSV       180
     KGQFEEKDTR TPLTIPRFWV PAGDGEALKR LAMEKTPQAV VKSKTRWQNK LVRNCYGLLK       240
     GSDPKLRKEM VVVDAAYDAS FRVLGLAPGA DEATSVAALL ILAEEFSRHP PARSVLFVAT       300
     VGNNESHDGM RHLIWSVKTK KKSLKKLTNQ LKDTKARIDD QYDLLEKGRY LEQEKPADRE       360
     SILEILVEKA KDRADALSRE IQYRRSASAL ELAEAQEGPR AYRQIAMVND IGRLTAQQRE       420
     LAVQLLDEAV EDRRATHKEL KVRVQAMKSS TALRGLLEEY TQVLFFDLHL SSHYETLGLI       480
     ETGETFPVRE SIRKISRAGR LIGLFTQSGR ETAAETGIPD IFRDTSRGAS PEEISVRAGS       540
     VCHPASDVAS IAGLPAVSLV SLEDRRLLWS TPADTLDRMD RKKVETLSGF LPPALRRLFS       600
     EPSLKSAVDA GVSGLSNLEG QAMFIRQGEL FPDQPASGTI ISILQGDSVF RTMVLRDGTY       660
     FMPGLANKRV SLEKLILEPY GIDPATGRIG IAADKAKTGK ENYRISVKSD LASAPLIMFR       720
     CLQTDILPIF NPRNMGYLTK LELIDAATEA PPLRHWYSRV DGRDTMSISL FLEKGTRFKL       780
     IMSESLLGKE FFLLNGIPEN PNGIGFLVGE PPTVSVAPYH VAKDLYSLVG GRLRNLFQHG       840
     IVNVHLEELY RQAGTELEQG ILALSEHRYG DFWDRVATAW AKLDIVYAEV EGNQRDVLGG       900
     VMFFIALFVP FAYCMERYIF CFRGIYQQIV AFFLILIMTI LAIRGLHPAF QLTYSPMVVI       960
     IAFFIVGLSL LVSAIIFIRF EKEMEDLQTR QAHLRTPQAS KWQAFGAGFS IGVSNLNRRK      1020
     LRTGLTCVTL IILTFTVMSF TNVKSLHRST LTRIAEDNPY EGVLLRHQFR LPMTMLTLED      1080
     MKARFGPEGA SIWPRGWIEP AGLTERTISA VYASGRHAPV EGLLGLGPSA PEVFTRLVTK      1140
     GRWLNETDDR AVLLPLAMAA RLGLDPERDL NVPVEIMGAR FTVVGFFDGS ALDEAKDLDR      1200
     HPITPAYLEV SHGEELSEVE IEAMQTGEEL LPQTERFRYA AGNRTVIMPF AKCVEYGGKL      1260
     KAVSILPRSS PTEIADRLST WLAYPLFVGE NGTWYHSAST TLRYSGVANL LVPILIVIFI      1320
     TLNTMIGHVH ERQKEISTYT SVGLAPTHVG FLFIVEALSL AVISTVLGYI LAQLSAKYLG      1380
     NTAMFSQLTF NYSSLASVAC MFLVFSVVFL AALYPARLAA QIAMPDVNRS WTLPAPEGDV      1440
     IHMNLPFLLK AEEEAGIMKF LKAFYGSHQD VAHGSFIVDE IDMDDALPPV RPGQNPIPVC      1500
     IVIRTNAWLA PFDFAIKQRV HLHCCPSEEN PGYLEIAIQM TRISGERSAW VRANNSFIKA      1560
     LRKQMLLWRL LDADTKAIYY LPEQSETAG                                        1589
//

If you have problems or comments...

PBIL Back to PBIL home page