(data stored in ACNUC7421 zone)

EMBL: CP000478.PE250

CP000478.PE250       Location/Qualifiers
FT   CDS             complement(300093..300749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0253"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   dps:DP1753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15954"
FT                   /db_xref="GOA:A0LEV2"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV2"
FT                   /protein_id="ABK15954.1"
FT                   /translation="MDDRIQRQVVLPFSQLVKISFNSIRVRFFRSLITTLTLALAVAFV
FT                   SFTWSGYELLNAFFPHADGTVQAGILAGGYELENGRFGAGAKDQWLVILSLLVCVVGIV
FT                   NAQLMAVTERFREIGTFKCLGALDSFVVRIFVLESIYQGLFGGFVGGLAGVLIATGSFL
FT                   FRAGWICLACWPPGSMLLTVAGTTLLAVVLSLLGAIYPALVAAKMQPAIALRNEE"
     MDDRIQRQVV LPFSQLVKIS FNSIRVRFFR SLITTLTLAL AVAFVSFTWS GYELLNAFFP        60
     HADGTVQAGI LAGGYELENG RFGAGAKDQW LVILSLLVCV VGIVNAQLMA VTERFREIGT       120
     FKCLGALDSF VVRIFVLESI YQGLFGGFVG GLAGVLIATG SFLFRAGWIC LACWPPGSML       180
     LTVAGTTLLA VVLSLLGAIY PALVAAKMQP AIALRNEE                               218
//

If you have problems or comments...

PBIL Back to PBIL home page