(data stored in ACNUC7421 zone)

EMBL: CP000478.PE253

CP000478.PE253       Location/Qualifiers
FT   CDS             complement(304391..306253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15957"
FT                   /db_xref="GOA:A0LEV5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV5"
FT                   /protein_id="ABK15957.1"
FT                   /translation="MSELLHSFHIPVMGTAFTIESPFKVARYGISSVISLVDDTLIEKM
FT                   RRFYCRVMGRECTHIRKQDHDSRADRITAYLNLMDEAVKEQFEKLKASAFEMGSEITKY
FT                   FELLPETSPLKQLYKAMQSLKDSVEKRRIQDELRERIKPGAIDVNIMTKVDRHTFDGNG
FT                   EPLPSEFSDALAALRGYARSSVESSIVFSAGFNGRLYGYAEQFDDFHADENGNIKKKIV
FT                   IKVNDYRSALTQGKFFAKKGLWVSEFRLESGLNCGGHAFAHGGALMGPSLEEFRNRKDE
FT                   LIATLFEIYNRALRQKKKRTFDRPHALRITAQGGIGTAGEQSFLLRHYRLDATGWGTPF
FT                   LLVPEATTVDPTTLKRLCEAGREDLFLSDVSPLGVPFNNLRTSLSEEAKRARIRTGKPG
FT                   SPCTKGYLKSNTEFSETPICVASRAYQERKIEQILAGGSDPESARAAIEAVTSKSCLCT
FT                   DLGGTAILTHGLAESEDGPCVPAICPGPGLAYFTRAVSLREMVDHIYGRADIIENRTRP
FT                   NLFISELEMYIDYFDNELRRSLPHPNEQTAKYLREFETNLLEGIAYYQELIPRWSDGPP
FT                   EYRARMKRDLGLCRERLLEVASHFHDMPSLDPDAGLAIGRETAL"
     MSELLHSFHI PVMGTAFTIE SPFKVARYGI SSVISLVDDT LIEKMRRFYC RVMGRECTHI        60
     RKQDHDSRAD RITAYLNLMD EAVKEQFEKL KASAFEMGSE ITKYFELLPE TSPLKQLYKA       120
     MQSLKDSVEK RRIQDELRER IKPGAIDVNI MTKVDRHTFD GNGEPLPSEF SDALAALRGY       180
     ARSSVESSIV FSAGFNGRLY GYAEQFDDFH ADENGNIKKK IVIKVNDYRS ALTQGKFFAK       240
     KGLWVSEFRL ESGLNCGGHA FAHGGALMGP SLEEFRNRKD ELIATLFEIY NRALRQKKKR       300
     TFDRPHALRI TAQGGIGTAG EQSFLLRHYR LDATGWGTPF LLVPEATTVD PTTLKRLCEA       360
     GREDLFLSDV SPLGVPFNNL RTSLSEEAKR ARIRTGKPGS PCTKGYLKSN TEFSETPICV       420
     ASRAYQERKI EQILAGGSDP ESARAAIEAV TSKSCLCTDL GGTAILTHGL AESEDGPCVP       480
     AICPGPGLAY FTRAVSLREM VDHIYGRADI IENRTRPNLF ISELEMYIDY FDNELRRSLP       540
     HPNEQTAKYL REFETNLLEG IAYYQELIPR WSDGPPEYRA RMKRDLGLCR ERLLEVASHF       600
     HDMPSLDPDA GLAIGRETAL                                                   620
//

If you have problems or comments...

PBIL Back to PBIL home page