(data stored in ACNUC7421 zone)

EMBL: CP000478.PE254

CP000478.PE254       Location/Qualifiers
FT   CDS             complement(306763..308058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0257"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   ade:Adeh_3810 tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15958"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV6"
FT                   /protein_id="ABK15958.1"
FT                   /translation="MNQAISQRDWITLVEILDAAINLLRGKNVDPVRLAILHFGNNASM
FT                   FGLPALARVANKLDAFLIQHLTPDYEDEPASLLCFAMEGVRTKMKTLGYDQDFSASLEE
FT                   TVQFLEFFSEAENWPSHTGYTLTNDARVTVPARQAHPPESSPETPDEPVSLDYSLDSAG
FT                   LEESPQSVQSSTETPGSEPLHPGDSTPRQLEMTFPGGAPAAAHAAPPQGAEGASSAGEK
FT                   RRTRRALQHLIEEAGRAAAAFKPEDQSADEVMAYKTLLKHDPRSLVFAMLADALCSQGR
FT                   WAEAVEVCEQGLIFHPQHLRARVLLGWALWELKESREAFVVLSGAREEMEKNALVYLVL
FT                   SKIVETEEPEKSREYREIHRKLQPAGGKPPIPEDVPAEPETAAMQSSTLLSFLSRLGAE
FT                   FHDRKLLRQRGIDLLSARERQALMEAFRSAMN"
     MNQAISQRDW ITLVEILDAA INLLRGKNVD PVRLAILHFG NNASMFGLPA LARVANKLDA        60
     FLIQHLTPDY EDEPASLLCF AMEGVRTKMK TLGYDQDFSA SLEETVQFLE FFSEAENWPS       120
     HTGYTLTNDA RVTVPARQAH PPESSPETPD EPVSLDYSLD SAGLEESPQS VQSSTETPGS       180
     EPLHPGDSTP RQLEMTFPGG APAAAHAAPP QGAEGASSAG EKRRTRRALQ HLIEEAGRAA       240
     AAFKPEDQSA DEVMAYKTLL KHDPRSLVFA MLADALCSQG RWAEAVEVCE QGLIFHPQHL       300
     RARVLLGWAL WELKESREAF VVLSGAREEM EKNALVYLVL SKIVETEEPE KSREYREIHR       360
     KLQPAGGKPP IPEDVPAEPE TAAMQSSTLL SFLSRLGAEF HDRKLLRQRG IDLLSARERQ       420
     ALMEAFRSAM N                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page