(data stored in ACNUC7421 zone)

EMBL: CP000478.PE257

CP000478.PE257       Location/Qualifiers
FT   CDS             311600..313495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0260"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: sma:SAV7237 putative DnaK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15961"
FT                   /db_xref="GOA:A0LEV9"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEV9"
FT                   /protein_id="ABK15961.1"
FT                   /translation="MAKAVGIDLGTTNSVVAIWENGAATVIANSEGSRTTPSVVGYTED
FT                   GQRLVGQIARRQAILNPSATVYSAKRFIGRKWGEVDEESKIVSYKVVRGQGDVVRFEVR
FT                   GKTVAPEEVSAQVLRKLVDDASKYLGEKVTEAVITTPAYFNDAQRQATKDAGEIAGLKV
FT                   LRIINEPTAAALAYGLEKKKNETIMVFDLGGGTFDVSILDVGEGVCEVRSTSGDTHLGG
FT                   DDFDKRVVDWLADEFKKETGIDLRGDRQSLQRLYEAAEKAKCELSSTTETQVNLPFITA
FT                   DSTGPKHLVMKLTRAKFEDLTHELVQRCMKPVEQALADARLTAKDIDEVILVGGSTRIP
FT                   AVQELVKKLTGGKQPNMSVNPDEVVAVGAAVQAAVLKGEVEDVVLLDVTPLSLGVETLG
FT                   GVMTRLIERNTTIPSRREEVFSTAEDNQSAVDIVVLQGEREMARDNRVLGRFRLEGIRP
FT                   APRGVPQVKVIFDIDANGILSVTARDQETGKEQNVTISESTNLPKSEVERMVNDARSHA
FT                   SEDKTRRETIENRNQADSLAYQLERSLKDFGDKVPLHEKARSEQLVQDARAAVKDESTG
FT                   KERYQQLISDLQQAVQMVSAAAYSQAGGAQAGAAGGTRERPAGGDDVIDAEFTER"
     MAKAVGIDLG TTNSVVAIWE NGAATVIANS EGSRTTPSVV GYTEDGQRLV GQIARRQAIL        60
     NPSATVYSAK RFIGRKWGEV DEESKIVSYK VVRGQGDVVR FEVRGKTVAP EEVSAQVLRK       120
     LVDDASKYLG EKVTEAVITT PAYFNDAQRQ ATKDAGEIAG LKVLRIINEP TAAALAYGLE       180
     KKKNETIMVF DLGGGTFDVS ILDVGEGVCE VRSTSGDTHL GGDDFDKRVV DWLADEFKKE       240
     TGIDLRGDRQ SLQRLYEAAE KAKCELSSTT ETQVNLPFIT ADSTGPKHLV MKLTRAKFED       300
     LTHELVQRCM KPVEQALADA RLTAKDIDEV ILVGGSTRIP AVQELVKKLT GGKQPNMSVN       360
     PDEVVAVGAA VQAAVLKGEV EDVVLLDVTP LSLGVETLGG VMTRLIERNT TIPSRREEVF       420
     STAEDNQSAV DIVVLQGERE MARDNRVLGR FRLEGIRPAP RGVPQVKVIF DIDANGILSV       480
     TARDQETGKE QNVTISESTN LPKSEVERMV NDARSHASED KTRRETIENR NQADSLAYQL       540
     ERSLKDFGDK VPLHEKARSE QLVQDARAAV KDESTGKERY QQLISDLQQA VQMVSAAAYS       600
     QAGGAQAGAA GGTRERPAGG DDVIDAEFTE R                                      631
//

If you have problems or comments...

PBIL Back to PBIL home page