(data stored in ACNUC7421 zone)

EMBL: CP000478.PE258

CP000478.PE258       Location/Qualifiers
FT   CDS             313700..314674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0261"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: noc:Noc_1382 heat
FT                   shock protein DnaJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15962"
FT                   /db_xref="GOA:A0LEW0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW0"
FT                   /protein_id="ABK15962.1"
FT                   /translation="MAVKFRDYYEVLGVPRTATQEEIQRSYRKLARKFHPDVNKARDAE
FT                   DKFKEINEAYEVLKDPEKRKKYDLLGENWKTGQEFRPPPGWDYQYDFGRGGGQGEFQWG
FT                   GSGGFSDFFEMLFGGQRGGRARGGARRGGGPVWSQAGADQEATVRISLEDAFHGATKSI
FT                   TLQMQSLTPDGQVAVQEKTYEVKIPVGIMSGRKIRLSGQGGEGMGGGPRGDLYLKIEIE
FT                   PHAVYRLKDRDIYVDLPVAPWEAVLGADVQLTTLSGQVTLKIPPGTQSGQKLRLRGKGM
FT                   PNPKETAGDLYVVVQIMVPKHPSRREQELFEELRKESAFNPRL"
     MAVKFRDYYE VLGVPRTATQ EEIQRSYRKL ARKFHPDVNK ARDAEDKFKE INEAYEVLKD        60
     PEKRKKYDLL GENWKTGQEF RPPPGWDYQY DFGRGGGQGE FQWGGSGGFS DFFEMLFGGQ       120
     RGGRARGGAR RGGGPVWSQA GADQEATVRI SLEDAFHGAT KSITLQMQSL TPDGQVAVQE       180
     KTYEVKIPVG IMSGRKIRLS GQGGEGMGGG PRGDLYLKIE IEPHAVYRLK DRDIYVDLPV       240
     APWEAVLGAD VQLTTLSGQV TLKIPPGTQS GQKLRLRGKG MPNPKETAGD LYVVVQIMVP       300
     KHPSRREQEL FEELRKESAF NPRL                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page