(data stored in ACNUC7421 zone)

EMBL: CP000478.PE26

CP000478.PE26        Location/Qualifiers
FT   CDS             39107..39952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0027"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="KEGG: mta:Moth_0067 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15730"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE78"
FT                   /protein_id="ABK15730.1"
FT                   /translation="MLRKSVLAGAVLVALVCFGFIGVRDGDCAEPQIKDLILATTTSTV
FT                   DTGLLDALIPKFEKETGYRVKTISAGTGQALAMGEKGEADVLLVHAPEAEKKLVDGGMV
FT                   INYQLVMHNDFVIVGPAGDPAGIKGKPSADALKAVAAKEAVFISRGDDSGTHKKEKSLW
FT                   KKVEIQPAGKWYRESGQGMGATLLMASEQQGYTLTDRGTYLAQKKNVKLDILSEGDKAL
FT                   LNIYHVMQVNPEKFAKVNGPGAKAFVEFMVRPDVQKFIGEFGKDKFGQPLFFPDAGKQM
FT                   "
     MLRKSVLAGA VLVALVCFGF IGVRDGDCAE PQIKDLILAT TTSTVDTGLL DALIPKFEKE        60
     TGYRVKTISA GTGQALAMGE KGEADVLLVH APEAEKKLVD GGMVINYQLV MHNDFVIVGP       120
     AGDPAGIKGK PSADALKAVA AKEAVFISRG DDSGTHKKEK SLWKKVEIQP AGKWYRESGQ       180
     GMGATLLMAS EQQGYTLTDR GTYLAQKKNV KLDILSEGDK ALLNIYHVMQ VNPEKFAKVN       240
     GPGAKAFVEF MVRPDVQKFI GEFGKDKFGQ PLFFPDAGKQ M                           281
//

If you have problems or comments...

PBIL Back to PBIL home page