(data stored in ACNUC7421 zone)

EMBL: CP000478.PE260

CP000478.PE260       Location/Qualifiers
FT   CDS             315111..317732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0263"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: pca:Pcar_0359 putative ATPase with
FT                   chaperone activity, two ATP-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15964"
FT                   /db_xref="GOA:A0LEW2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW2"
FT                   /protein_id="ABK15964.1"
FT                   /translation="MDLNKLTIKSQEALKAAETKAIRYGHVEVDVEHLLLALLEQSQGL
FT                   IPSLLRKMDVQVDRLRERLEQELEKKPRVSGPGIEPGKVYITQRLNQLLIKAEEEAGRL
FT                   KDEYVSVEHLLLAFIQEGGATPAGRLLQENRVGKDAFLQTLTSVRGNQRVTSASPETTY
FT                   EALQKYGRDLVQEARTNKLDPVIGRDSEIRRVVRILSRKTKNNPVLIGEPGVGKTAIVE
FT                   GLAHRIVRGDVPEGLKDKAIFALDMGALVAGAKYRGEFEERLKAVLQEIKESEGGILLF
FT                   IDELHTIVGAGKAEGSMDAGNMLKPMLARGELHCIGATTLDEYRKYIEKDAALERRFQP
FT                   VLVDQPTVEDTISILRGLKERYEVHHGVKIQDSALVAAAVLSGRYITDRFLPDKAIDLV
FT                   DEACAMIRTEIDSRPEELDEVMRRVMQLEIEEVALKKEKDKASQERLEALRKEIGELRA
FT                   RTDAMSAQWEAEKQAIKKVQAIREEIEKVRRDIEVAERQFDLQKVAELKHGLMPDLEKK
FT                   LKTEEGGLSADPDGNRLLREEVTEEEIAEIISRWTGIPVTRLVEGEREKLLRLDEVLHR
FT                   RIVGQNEAVSLVADAVIRARSGIKDPRRPIGSFIFLGPTGVGKTELGKALAEALFDSED
FT                   NVVRIDMSEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILFDEIEKAHPDV
FT                   FNVLLQLLDDGRLTDAQGRTVDFKNTVVIMTSNIGSVYLLDGVTDDGQIKERAREQVMS
FT                   DLRRQFRPEFLNRVDDIVLFKPLTVGEIEKIIDLLTKDLTRRLKDRRIELELTGQAREF
FT                   IARAGYDPVFGARPLKRFLQHNLETRIGRALIAGDIPDGSTIRVDIQDGDLSVTHTVNE
FT                   NE"
     MDLNKLTIKS QEALKAAETK AIRYGHVEVD VEHLLLALLE QSQGLIPSLL RKMDVQVDRL        60
     RERLEQELEK KPRVSGPGIE PGKVYITQRL NQLLIKAEEE AGRLKDEYVS VEHLLLAFIQ       120
     EGGATPAGRL LQENRVGKDA FLQTLTSVRG NQRVTSASPE TTYEALQKYG RDLVQEARTN       180
     KLDPVIGRDS EIRRVVRILS RKTKNNPVLI GEPGVGKTAI VEGLAHRIVR GDVPEGLKDK       240
     AIFALDMGAL VAGAKYRGEF EERLKAVLQE IKESEGGILL FIDELHTIVG AGKAEGSMDA       300
     GNMLKPMLAR GELHCIGATT LDEYRKYIEK DAALERRFQP VLVDQPTVED TISILRGLKE       360
     RYEVHHGVKI QDSALVAAAV LSGRYITDRF LPDKAIDLVD EACAMIRTEI DSRPEELDEV       420
     MRRVMQLEIE EVALKKEKDK ASQERLEALR KEIGELRART DAMSAQWEAE KQAIKKVQAI       480
     REEIEKVRRD IEVAERQFDL QKVAELKHGL MPDLEKKLKT EEGGLSADPD GNRLLREEVT       540
     EEEIAEIISR WTGIPVTRLV EGEREKLLRL DEVLHRRIVG QNEAVSLVAD AVIRARSGIK       600
     DPRRPIGSFI FLGPTGVGKT ELGKALAEAL FDSEDNVVRI DMSEYMEKHA VSRLIGAPPG       660
     YVGYEEGGQL TEAVRRKPYS VILFDEIEKA HPDVFNVLLQ LLDDGRLTDA QGRTVDFKNT       720
     VVIMTSNIGS VYLLDGVTDD GQIKERAREQ VMSDLRRQFR PEFLNRVDDI VLFKPLTVGE       780
     IEKIIDLLTK DLTRRLKDRR IELELTGQAR EFIARAGYDP VFGARPLKRF LQHNLETRIG       840
     RALIAGDIPD GSTIRVDIQD GDLSVTHTVN ENE                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page