(data stored in ACNUC7421 zone)

EMBL: CP000478.PE261

CP000478.PE261       Location/Qualifiers
FT   CDS             317974..318318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0264"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: sat:SYN_00341
FT                   transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15965"
FT                   /db_xref="GOA:A0LEW3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW3"
FT                   /protein_id="ABK15965.1"
FT                   /translation="MRTFIKVMKALSDPNRLKILKMLQERTLCVCEIQASLGLAQPTVS
FT                   NHLKLLENAGLVCAKKNGPWVDYSLSDGSVNRYAAALLGNLKHWLRDEPEILRVTENLP
FT                   NIRRQDVCGK"
     MRTFIKVMKA LSDPNRLKIL KMLQERTLCV CEIQASLGLA QPTVSNHLKL LENAGLVCAK        60
     KNGPWVDYSL SDGSVNRYAA ALLGNLKHWL RDEPEILRVT ENLPNIRRQD VCGK             114
//

If you have problems or comments...

PBIL Back to PBIL home page