(data stored in ACNUC7421 zone)

EMBL: CP000478.PE263

CP000478.PE263       Location/Qualifiers
FT   CDS             complement(319694..320533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0266"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: gka:GK0592
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15967"
FT                   /db_xref="GOA:A0LEW5"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW5"
FT                   /protein_id="ABK15967.1"
FT                   /translation="MKAEEIRKAVRSGYARVARLEGSCCGKTGRSCCGGDAGSLPDDVG
FT                   LQIGYGEDELKTVPEGANLGLGCGNPTAIAALREGETVLDLGSGAGFDCFLAAAKVGPS
FT                   GRVIGVDMTPEMIAKAQENALKGGYANTEFRFGEIENLPVEDSSVDVIVSNCVINLSPD
FT                   KPKVFKEAFRVLKPGGRFIVSDIVLTAELPEFIRNSMDAYVACLSGAVLKREYLAGIET
FT                   AGFRHVRVVNETVFPIELVAADPAVRETAGNSGLSSEDACSFADSITSITVAAIKPL"
     MKAEEIRKAV RSGYARVARL EGSCCGKTGR SCCGGDAGSL PDDVGLQIGY GEDELKTVPE        60
     GANLGLGCGN PTAIAALREG ETVLDLGSGA GFDCFLAAAK VGPSGRVIGV DMTPEMIAKA       120
     QENALKGGYA NTEFRFGEIE NLPVEDSSVD VIVSNCVINL SPDKPKVFKE AFRVLKPGGR       180
     FIVSDIVLTA ELPEFIRNSM DAYVACLSGA VLKREYLAGI ETAGFRHVRV VNETVFPIEL       240
     VAADPAVRET AGNSGLSSED ACSFADSITS ITVAAIKPL                              279
//

If you have problems or comments...

PBIL Back to PBIL home page