(data stored in ACNUC7421 zone)

EMBL: CP000478.PE266

CP000478.PE266       Location/Qualifiers
FT   CDS             322987..325224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0269"
FT                   /product="peptidase S15"
FT                   /note="PFAM: peptidase S15; X-Pro dipeptidyl-peptidase
FT                   C-terminal domain protein; KEGG: sfr:Sfri_3839 peptidase
FT                   S15"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15970"
FT                   /db_xref="GOA:A0LEW8"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW8"
FT                   /protein_id="ABK15970.1"
FT                   /translation="MPGHAGEGGRPAAAGPPEGIDSLPAPFPARDKVPDPERITFTVRY
FT                   PGKDPIKLEGHFWYNKDARAAGRKCPAIVELNPYRRRDGMMSSDSGYYPWFAYHEYLCF
FT                   RVDLQGAGDSQGILIDEYTDEELVYCTQVIEQIAVHPSCDGNVGMTGTSWSAINSLMVA
FT                   ARADCPPALKAVLVICGTDDRYNDDVHYMNGAMMQDNIGWASSMFGWLAQPPDPLVVGD
FT                   RWKSMWRERIRAADFWFKHWGKHQARDLYWSASSVRDRYGRVQVPVYIVSGYQDGYKNP
FT                   VPRVVGGLRAAGMPVQGLLGPWGHACPNSGYPGPRIDWLPYVLTHWWDRWLKGKTPDPD
FT                   AELPEMTVWLGESKEPGSSSCRPEKGRWAAEDGEWTTRVRERIFYLWPDGRLRSGLPDS
FT                   GATYVGTGDLVVAARMLETSSWGHCGNNDLPGDQSQADAASLHFDSAPLPKDLDCFGYP
FT                   TACLKLSCNKPVASIAVRLCEVSPDTGASHLVSYRFFNLCCRDGDMAKPRPVEPGVVFD
FT                   VVVPLNVIGHTFKQGWRIRLSVSPSFFPTMCPSPELATITVYAGRAGTGSRMSALSLPE
FT                   RKPRPEDGRLESLLPPAPRILWVDSGTYVPTVTARNGEDSRLVRQFTVLGRKGTVVRKT
FT                   TDYGRYRYDGPLEGLWVDEVDRENFIVVHDEPLTFCGFTSSRVILDRNTGGSHWKVMAR
FT                   RTTKVSTEWDSGGRLVFRYKATIRTFIGKPGGGWEPFENKTVEGTIPRLWV"
     MPGHAGEGGR PAAAGPPEGI DSLPAPFPAR DKVPDPERIT FTVRYPGKDP IKLEGHFWYN        60
     KDARAAGRKC PAIVELNPYR RRDGMMSSDS GYYPWFAYHE YLCFRVDLQG AGDSQGILID       120
     EYTDEELVYC TQVIEQIAVH PSCDGNVGMT GTSWSAINSL MVAARADCPP ALKAVLVICG       180
     TDDRYNDDVH YMNGAMMQDN IGWASSMFGW LAQPPDPLVV GDRWKSMWRE RIRAADFWFK       240
     HWGKHQARDL YWSASSVRDR YGRVQVPVYI VSGYQDGYKN PVPRVVGGLR AAGMPVQGLL       300
     GPWGHACPNS GYPGPRIDWL PYVLTHWWDR WLKGKTPDPD AELPEMTVWL GESKEPGSSS       360
     CRPEKGRWAA EDGEWTTRVR ERIFYLWPDG RLRSGLPDSG ATYVGTGDLV VAARMLETSS       420
     WGHCGNNDLP GDQSQADAAS LHFDSAPLPK DLDCFGYPTA CLKLSCNKPV ASIAVRLCEV       480
     SPDTGASHLV SYRFFNLCCR DGDMAKPRPV EPGVVFDVVV PLNVIGHTFK QGWRIRLSVS       540
     PSFFPTMCPS PELATITVYA GRAGTGSRMS ALSLPERKPR PEDGRLESLL PPAPRILWVD       600
     SGTYVPTVTA RNGEDSRLVR QFTVLGRKGT VVRKTTDYGR YRYDGPLEGL WVDEVDRENF       660
     IVVHDEPLTF CGFTSSRVIL DRNTGGSHWK VMARRTTKVS TEWDSGGRLV FRYKATIRTF       720
     IGKPGGGWEP FENKTVEGTI PRLWV                                             745
//

If you have problems or comments...

PBIL Back to PBIL home page