(data stored in ACNUC7421 zone)

EMBL: CP000478.PE267

CP000478.PE267       Location/Qualifiers
FT   CDS             complement(325248..325730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0270"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   tko:TK0711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15971"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEW9"
FT                   /protein_id="ABK15971.1"
FT                   /translation="MQGLTCFPVGVIRSPYKEIQGMPIQAKGAEGVPGTVELNAELEGG
FT                   LKDLQGFSHIILIYHFHRSEGYSLEVKPFLDDRCHGVFATRAPRRPNPIGISIVRLLKV
FT                   EGNILHIEDVDVLDGTPLLDIKPYIPEFDARETDRIGWLSGKAGRVKETRADDRFK"
     MQGLTCFPVG VIRSPYKEIQ GMPIQAKGAE GVPGTVELNA ELEGGLKDLQ GFSHIILIYH        60
     FHRSEGYSLE VKPFLDDRCH GVFATRAPRR PNPIGISIVR LLKVEGNILH IEDVDVLDGT       120
     PLLDIKPYIP EFDARETDRI GWLSGKAGRV KETRADDRFK                             160
//

If you have problems or comments...

PBIL Back to PBIL home page