(data stored in ACNUC7421 zone)

EMBL: CP000478.PE27

CP000478.PE27        Location/Qualifiers
FT   CDS             39986..40678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0028"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sat:SYN_00838 ABC-type
FT                   tungstate transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15731"
FT                   /db_xref="GOA:A0LE79"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE79"
FT                   /protein_id="ABK15731.1"
FT                   /translation="MNVISEGIVEAARLLVTLDPDVVAITLRTLQVSTTATFISVLIGL
FT                   PFGTFLALTRFFGRGFVVSLVNFGMGLPPVVVGLVTWLFLTRYGPLGTLGLLYSPTAMV
FT                   IAQAVIASPIVAGFAMAAIQSVNPKLRLQILSLGATRIQFLFLLLWEARLGILAAVIAG
FT                   FGGVISEVGASMMVGGNVRGYTRVLTTATVLEVSKGSFALATGLSIILLALSFGIMASL
FT                   SYLQQRGR"
     MNVISEGIVE AARLLVTLDP DVVAITLRTL QVSTTATFIS VLIGLPFGTF LALTRFFGRG        60
     FVVSLVNFGM GLPPVVVGLV TWLFLTRYGP LGTLGLLYSP TAMVIAQAVI ASPIVAGFAM       120
     AAIQSVNPKL RLQILSLGAT RIQFLFLLLW EARLGILAAV IAGFGGVISE VGASMMVGGN       180
     VRGYTRVLTT ATVLEVSKGS FALATGLSII LLALSFGIMA SLSYLQQRGR                  230
//

If you have problems or comments...

PBIL Back to PBIL home page