(data stored in ACNUC7421 zone)

EMBL: CP000478.PE273

CP000478.PE273       Location/Qualifiers
FT   CDS             complement(329911..330327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0276"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: rxy:Rxyl_2392 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15977"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX5"
FT                   /protein_id="ABK15977.1"
FT                   /translation="MLHGYRSRKDMPEPKGKKARPEQGKRERYMQPSILLGLYPKPSYG
FT                   YELIQNIQRFGFVEGQAPPGMIYRHLHQLEGDGLVSSEWDTGAGPAKRMYRLTEEGRQM
FT                   LALWVEYMERQARNLSAFVEQYRSTRAAGSAEPS"
     MLHGYRSRKD MPEPKGKKAR PEQGKRERYM QPSILLGLYP KPSYGYELIQ NIQRFGFVEG        60
     QAPPGMIYRH LHQLEGDGLV SSEWDTGAGP AKRMYRLTEE GRQMLALWVE YMERQARNLS       120
     AFVEQYRSTR AAGSAEPS                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page