(data stored in ACNUC7421 zone)

EMBL: CP000478.PE275

CP000478.PE275       Location/Qualifiers
FT   CDS             331731..331979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15979"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX7"
FT                   /protein_id="ABK15979.1"
FT                   /translation="MPPGADRVSLTVFLLCAIVTYILAAPAVSLGFRGQFLPHQSPIRI
FT                   RVVSERIPVFSTLSARGGPENLRFHAMSKRFFKPHGC"
     MPPGADRVSL TVFLLCAIVT YILAAPAVSL GFRGQFLPHQ SPIRIRVVSE RIPVFSTLSA        60
     RGGPENLRFH AMSKRFFKPH GC                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page