(data stored in ACNUC7421 zone)

EMBL: CP000478.PE276

CP000478.PE276       Location/Qualifiers
FT   CDS             complement(332111..333193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0279"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: pca:Pcar_0532 ISGsu4, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15980"
FT                   /db_xref="GOA:A0LEX8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX8"
FT                   /protein_id="ABK15980.1"
FT                   /translation="MGLYAGIDLHASSNYLAIVDESGKRTLRCKLPNDGEEVVSALEPY
FT                   RDQMMGVAVESTFNWYWLVDTLNESGLRVHLANPAAIQKYSGLKHCDDKYDAFWLAEML
FT                   RLGILPEGYIYPKEERPLRDLLRKRGHLVKLRTSLILSLQNIVARNRGLRVNANEVKRL
FT                   KKNRIPPLLEENEDLAMAGRVSKETIDFLTRMIRDIEIAVARKTSLKDSYRNLLTIPGI
FT                   GRILALTIMLETGPIGRFPKVGNYVSYCRKVGSRWTSNEKAKGKGNKKNGNKYLAWAFS
FT                   EAAELARRFDPECRSYYNRKMHRSNFLVAHQALAHKLARAAYYLMKDNVVFMPEKLFGR
FT                   SPPAQEPGRAHVPCRERGTR"
     MGLYAGIDLH ASSNYLAIVD ESGKRTLRCK LPNDGEEVVS ALEPYRDQMM GVAVESTFNW        60
     YWLVDTLNES GLRVHLANPA AIQKYSGLKH CDDKYDAFWL AEMLRLGILP EGYIYPKEER       120
     PLRDLLRKRG HLVKLRTSLI LSLQNIVARN RGLRVNANEV KRLKKNRIPP LLEENEDLAM       180
     AGRVSKETID FLTRMIRDIE IAVARKTSLK DSYRNLLTIP GIGRILALTI MLETGPIGRF       240
     PKVGNYVSYC RKVGSRWTSN EKAKGKGNKK NGNKYLAWAF SEAAELARRF DPECRSYYNR       300
     KMHRSNFLVA HQALAHKLAR AAYYLMKDNV VFMPEKLFGR SPPAQEPGRA HVPCRERGTR       360
//

If you have problems or comments...

PBIL Back to PBIL home page