(data stored in ACNUC7421 zone)

EMBL: CP000478.PE277

CP000478.PE277       Location/Qualifiers
FT   CDS             333984..334586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0280"
FT                   /product="protein of unknown function DUF1287"
FT                   /note="PFAM: protein of unknown function DUF1287; KEGG:
FT                   hch:HCH_06899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15981"
FT                   /db_xref="InterPro:IPR009706"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEX9"
FT                   /protein_id="ABK15981.1"
FT                   /translation="MLLAATVPLSAAQESPESRVVRAAREQVGKTIRYDPGYEKLAYPG
FT                   GDVPLERGVCSDVVVRAYRAALQMDLQKLVHEDMILNFGGYPRLWGLKRPDSSIDHRRV
FT                   PNLQTYFKRMGYALPVTREAKDYKPGDLVTCTLPPNLPHIMIVSDRTNAGGVPLVIHNI
FT                   GAGAKEEDRLFEFPLTGHYRIKTNEPRVRRSVQGRAR"
     MLLAATVPLS AAQESPESRV VRAAREQVGK TIRYDPGYEK LAYPGGDVPL ERGVCSDVVV        60
     RAYRAALQMD LQKLVHEDMI LNFGGYPRLW GLKRPDSSID HRRVPNLQTY FKRMGYALPV       120
     TREAKDYKPG DLVTCTLPPN LPHIMIVSDR TNAGGVPLVI HNIGAGAKEE DRLFEFPLTG       180
     HYRIKTNEPR VRRSVQGRAR                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page