(data stored in ACNUC7421 zone)

EMBL: CP000478.PE280

CP000478.PE280       Location/Qualifiers
FT   CDS             complement(338235..339017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0283"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dvu:DVU2664 phosphate ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15984"
FT                   /db_xref="GOA:A0LEY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY2"
FT                   /protein_id="ABK15984.1"
FT                   /translation="MENNVIDQQVEPSVTIRGLSVRFSERTVLDRISFTACPGRIIVIV
FT                   GPSGSGKTTLLRAVNRLNECFPNCRTEGSVELRLNGRDGDIYRDFVPLPDLRRNVGMVF
FT                   QTPSVLPFSTRKNLAMPLKVTLGLDGARLSERVEWALREVSLWDEVKDRLHADASTLSG
FT                   GQQQRLCLARVLALEPQILLLDEPTASLDFKATEKIEELLTRLKKRYTILAVSHSLSQT
FT                   RRLADRVCVLREGRIVRELDHQHLQDLNEFQRLVEDAF"
     MENNVIDQQV EPSVTIRGLS VRFSERTVLD RISFTACPGR IIVIVGPSGS GKTTLLRAVN        60
     RLNECFPNCR TEGSVELRLN GRDGDIYRDF VPLPDLRRNV GMVFQTPSVL PFSTRKNLAM       120
     PLKVTLGLDG ARLSERVEWA LREVSLWDEV KDRLHADAST LSGGQQQRLC LARVLALEPQ       180
     ILLLDEPTAS LDFKATEKIE ELLTRLKKRY TILAVSHSLS QTRRLADRVC VLREGRIVRE       240
     LDHQHLQDLN EFQRLVEDAF                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page