(data stored in ACNUC7421 zone)

EMBL: CP000478.PE281

CP000478.PE281       Location/Qualifiers
FT   CDS             complement(339002..339880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0284"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dvu:DVU2665
FT                   phosphate ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15985"
FT                   /db_xref="GOA:A0LEY3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY3"
FT                   /protein_id="ABK15985.1"
FT                   /translation="MKTAADLLLTAYAWFCAIAVFLATSFLLGFLFKRGMGVMHPSLFF
FT                   GDTPWFSALLGASPVFEGIWPALVGTLALVLVSSVMAIPVGIASGIYLSEYASARVRSM
FT                   LGFAVDVLSGTPSIVMGLFGFTMILFLRKTALPQARPSLFLAAVCIALLILPYVIRTTQ
FT                   TAMEAIPEHLRLLGPSLGLTRWHHVRHVLLPSASRGILSGAILALGRASEDTAVIMLTG
FT                   VVARAGLPASLWDKFEALPFRIYTLAAEHRSVQELDQGFGMALVLLLMTGSLFAVASFL
FT                   QRSLEKRWKTT"
     MKTAADLLLT AYAWFCAIAV FLATSFLLGF LFKRGMGVMH PSLFFGDTPW FSALLGASPV        60
     FEGIWPALVG TLALVLVSSV MAIPVGIASG IYLSEYASAR VRSMLGFAVD VLSGTPSIVM       120
     GLFGFTMILF LRKTALPQAR PSLFLAAVCI ALLILPYVIR TTQTAMEAIP EHLRLLGPSL       180
     GLTRWHHVRH VLLPSASRGI LSGAILALGR ASEDTAVIML TGVVARAGLP ASLWDKFEAL       240
     PFRIYTLAAE HRSVQELDQG FGMALVLLLM TGSLFAVASF LQRSLEKRWK TT               292
//

If you have problems or comments...

PBIL Back to PBIL home page