(data stored in ACNUC7421 zone)

EMBL: CP000478.PE282

CP000478.PE282       Location/Qualifiers
FT   CDS             complement(339864..340748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: lip:LI1029 phosphate
FT                   transporter permease PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15986"
FT                   /db_xref="GOA:A0LEY4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY4"
FT                   /protein_id="ABK15986.1"
FT                   /translation="MNHVQLVRERWIRRSLLIATGISAGAILFIFVLLVYFCLPLITSG
FT                   GMSSVLSWQWKPFAGEFGILPMCAGSLLLSVFALGLAFPAAIGICGFATVLAARSLARF
FT                   TLVLVHFMTSIPTVIYGFVSVFLLVPLVRDWFSTGTGFSFLTAGLSLSLLILPTIVLVF
FT                   HARLQQIDPALRLAAEAMGLTPVRQFLHVLVPAASRGLVVAAILGFGRAIGDTLISLML
FT                   AGNAPRIPDSLFDSIRTLTAHIALVLATDSQSMSYRSVFASGLILFLLMGAANFFIRRM
FT                   DRGPGENRYENGR"
     MNHVQLVRER WIRRSLLIAT GISAGAILFI FVLLVYFCLP LITSGGMSSV LSWQWKPFAG        60
     EFGILPMCAG SLLLSVFALG LAFPAAIGIC GFATVLAARS LARFTLVLVH FMTSIPTVIY       120
     GFVSVFLLVP LVRDWFSTGT GFSFLTAGLS LSLLILPTIV LVFHARLQQI DPALRLAAEA       180
     MGLTPVRQFL HVLVPAASRG LVVAAILGFG RAIGDTLISL MLAGNAPRIP DSLFDSIRTL       240
     TAHIALVLAT DSQSMSYRSV FASGLILFLL MGAANFFIRR MDRGPGENRY ENGR             294
//

If you have problems or comments...

PBIL Back to PBIL home page