(data stored in ACNUC7421 zone)

EMBL: CP000478.PE283

CP000478.PE283       Location/Qualifiers
FT   CDS             complement(340790..341635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0286"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; KEGG:
FT                   dvu:DVU2667 phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15987"
FT                   /db_xref="GOA:A0LEY5"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEY5"
FT                   /protein_id="ABK15987.1"
FT                   /translation="MGIQKRRVDGVVILAVCFFFGLMQGVAFCGALDGFSGLEGTIAIA
FT                   GGTAHIPVMNDAAKNIMTVNPGIRITVEGGGSGVGVQKVGEGLADIGNTGRALSELEIA
FT                   KYGLKSFAFALDGVAAAVHPENPVSDLSPQQVRDIFAGSITNWKAVGGMDAPIHLFCRD
FT                   EASGTREVFWEKLLKKGPVAATANIVASNGAMKVAISQDKNAIGYVGIGHVDQSLKALK
FT                   LEGIAATQENAMNGSYPVVRKLYMNTRGEPSKLVRTFIDYVMGPECADIIKKYGYIPLK
FT                   "
     MGIQKRRVDG VVILAVCFFF GLMQGVAFCG ALDGFSGLEG TIAIAGGTAH IPVMNDAAKN        60
     IMTVNPGIRI TVEGGGSGVG VQKVGEGLAD IGNTGRALSE LEIAKYGLKS FAFALDGVAA       120
     AVHPENPVSD LSPQQVRDIF AGSITNWKAV GGMDAPIHLF CRDEASGTRE VFWEKLLKKG       180
     PVAATANIVA SNGAMKVAIS QDKNAIGYVG IGHVDQSLKA LKLEGIAATQ ENAMNGSYPV       240
     VRKLYMNTRG EPSKLVRTFI DYVMGPECAD IIKKYGYIPL K                           281
//

If you have problems or comments...

PBIL Back to PBIL home page