(data stored in ACNUC7421 zone)

EMBL: CP000478.PE288

CP000478.PE288       Location/Qualifiers
FT   CDS             349445..350029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15992"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ0"
FT                   /protein_id="ABK15992.1"
FT                   /translation="MVGLLLLASSGCGSRKQVQIPSEWRTPPSATTQAQRAPAAVPPST
FT                   APPPAPGLILKPPPQFKEKDVEPGLETIQPPVPEKKQAVVHPPQHLASMHLVDQARAEL
FT                   SRGRPDAAIPVLEQAVQVDVHNGDAFLGLARAWKMKGARRKAVEFAKKAEVLFQDDSRK
FT                   LKEAYLLEAELYRELGDTNKSNLYKQKASEL"
     MVGLLLLASS GCGSRKQVQI PSEWRTPPSA TTQAQRAPAA VPPSTAPPPA PGLILKPPPQ        60
     FKEKDVEPGL ETIQPPVPEK KQAVVHPPQH LASMHLVDQA RAELSRGRPD AAIPVLEQAV       120
     QVDVHNGDAF LGLARAWKMK GARRKAVEFA KKAEVLFQDD SRKLKEAYLL EAELYRELGD       180
     TNKSNLYKQK ASEL                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page