(data stored in ACNUC7421 zone)

EMBL: CP000478.PE289

CP000478.PE289       Location/Qualifiers
FT   CDS             350070..351245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0292"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   dde:Dde_2448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15993"
FT                   /db_xref="GOA:A0LEZ1"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ1"
FT                   /protein_id="ABK15993.1"
FT                   /translation="MSKRFLETLNGTPRFPGYRPFLLVVLFYSLYLTYLILHPFLDTLI
FT                   MSIVISSLFYPLQTWLVKKYRGRQTLAALTIVFIITFVIAIPIFFFASTLIAQGVQTIN
FT                   QINDWLRAGNIQKLAQDPRVMELMDWVQTRLSFLDLKKLDVSSNIMALSKNFGQFVLSR
FT                   AATILGNVASLVTHFFILVFISFYLVRDGAAMLDAARGFSPLRKDQEDRLLGGIRVVAR
FT                   SVLMGAFMTALCQGLIGGIGVALIGLPGLFWGTVMGFASFIPIVGTALVWVPMAAYLVL
FT                   LGTWKSALFLAIWCIVLVGSIDNFVRPYLMRGQSNLSPFYIFLSIIGAVQYFGLTGILY
FT                   GPLIVSFAMIMLYLYGAEYREDLAESKSGTHAVEEKAQETPGGELPASTGE"
     MSKRFLETLN GTPRFPGYRP FLLVVLFYSL YLTYLILHPF LDTLIMSIVI SSLFYPLQTW        60
     LVKKYRGRQT LAALTIVFII TFVIAIPIFF FASTLIAQGV QTINQINDWL RAGNIQKLAQ       120
     DPRVMELMDW VQTRLSFLDL KKLDVSSNIM ALSKNFGQFV LSRAATILGN VASLVTHFFI       180
     LVFISFYLVR DGAAMLDAAR GFSPLRKDQE DRLLGGIRVV ARSVLMGAFM TALCQGLIGG       240
     IGVALIGLPG LFWGTVMGFA SFIPIVGTAL VWVPMAAYLV LLGTWKSALF LAIWCIVLVG       300
     SIDNFVRPYL MRGQSNLSPF YIFLSIIGAV QYFGLTGILY GPLIVSFAMI MLYLYGAEYR       360
     EDLAESKSGT HAVEEKAQET PGGELPASTG E                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page