(data stored in ACNUC7421 zone)

EMBL: CP000478.PE29

CP000478.PE29        Location/Qualifiers
FT   CDS             42222..43301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0030"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /note="PFAM: ferredoxin; 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein; molybdopterin oxidoreductase Fe4S4
FT                   region; KEGG: sat:SYN_00630 formate dehydrogenase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15733"
FT                   /db_xref="GOA:A0LE81"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE81"
FT                   /protein_id="ABK15733.1"
FT                   /translation="MKDDIITLKVNGKDFKGREVKGKKGQTVLEVLRANDVHVPTLCYH
FT                   PQMPPYGGCRLCIVEIENMRGLPPSCTTPATDGMVVNTHSPKVVGVRKTVLELLLAYGD
FT                   HNCLLCEQTGSCELQNLVYEHGIDHVRIKSQFVPKIKDDSHPMIVRDHNKCVLCGRCVR
FT                   ACLQVQVNGAIDVAARGSDSYITTFNNTNLMESNCVSCGQCVQACPVGALTEKKSRFKG
FT                   RAWEMEKVRTTCPYCGVGCQMWLHVKDGRIVKVTGVEDGAPNEGRLCVKGRFGYDFIYS
FT                   EERLKTPLIKENGAFREASWDEALDLVAKKFTEIKKKHGPDAIAGVSSSRSLNEDSYQM
FT                   QKLFRAVIGTNNIDNCART"
     MKDDIITLKV NGKDFKGREV KGKKGQTVLE VLRANDVHVP TLCYHPQMPP YGGCRLCIVE        60
     IENMRGLPPS CTTPATDGMV VNTHSPKVVG VRKTVLELLL AYGDHNCLLC EQTGSCELQN       120
     LVYEHGIDHV RIKSQFVPKI KDDSHPMIVR DHNKCVLCGR CVRACLQVQV NGAIDVAARG       180
     SDSYITTFNN TNLMESNCVS CGQCVQACPV GALTEKKSRF KGRAWEMEKV RTTCPYCGVG       240
     CQMWLHVKDG RIVKVTGVED GAPNEGRLCV KGRFGYDFIY SEERLKTPLI KENGAFREAS       300
     WDEALDLVAK KFTEIKKKHG PDAIAGVSSS RSLNEDSYQM QKLFRAVIGT NNIDNCART        359
//

If you have problems or comments...

PBIL Back to PBIL home page