(data stored in ACNUC7421 zone)

EMBL: CP000478.PE291

CP000478.PE291       Location/Qualifiers
FT   CDS             complement(352631..355846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0294"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ade:Adeh_2805 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   histidine kinase A domain protein domain protein; PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15995"
FT                   /db_xref="GOA:A0LEZ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ3"
FT                   /protein_id="ABK15995.1"
FT                   /translation="MLDSGIVLSAFCLYMACLFLIALWVERKSAAGRSPANNPFVYSLS
FT                   LAVYCTAWTYYGSVGQAATSGFLFLPMYLGPTIAIMLWWSILRRLVHLRNSRRITSIAD
FT                   FISARYGRSQSVAAMVTLIALVGITPYVALQLKAIISTFEIITAADASSWIRADVGPLV
FT                   VVLMVVFTIILGVRRLDPTERHEGMMMALAVECVIKLLALLTVGIFVTYFMYDGFGDIF
FT                   RRFSESPFHHVFELGRHDAGSYVTWTGYLVLSMSAILFLPRQFHVAVVENHDEKHILTA
FT                   MWLLPLYLLLVSMFVLPIAAGGLLDGRPPDQADTFVLRIPLQHGKPWLSLLVFIGGFSA
FT                   AAGMIMITSVTMATMITNHLLLPLVQWIPGLAFVKRHLLKCRWGAVAGFIIIGYWFEER
FT                   IGESYMLVNIGLISFAAGLQFAPAILGGLFWRGGNKTGAILGLAGGFAVWSYTLLLPSF
FT                   IKSGWISNALLEKGAWGIELLKPEELFGLTGLNPLSHAVLWTMFVNIGLYVAGSLCSRE
FT                   RDEERSLAEEFVGVLGTPAPLRRARRWDAYIELAPKRSEIEKVFGQYFAEPEATAMVEK
FT                   CLFQTGIHQAARISIVQLVELHNEVERSLAGAIGSAAAHKALQQGTIFTPREAQELSEV
FT                   YGEILADLKVLPSELSERIDYYQERERLLLQQARELEEKVNELRKQIRKRKRAQAALRE
FT                   SEERYRTLVESTSDAILMVDKDRMIVSTNQAFLDLFGYERGELEGQSIRVVHPSEESYV
FT                   VFGQRAHHAIRTGAPFRTEWNLVRKDGTILPMEGSYSAIRGPDGSPTAYVAVIRDITER
FT                   KKAEEELKNYRDRLENMVRERTLQLEAAQKALVQREKLKTLGAIAAEVAHEIRNPLMSL
FT                   GGFAMRLQKKYPESPEVEIILEESRRLEKILDRIKDYLRPVDIRSRECPVNTVAAECVG
FT                   LLAQDLERERVVWQLDLAPELPPALVDPDVLGEVFVHVITHIAKVMDKQGLLTIRTYES
FT                   DRNIQIDFRYRLPAHKSVQDPERLFLPFEEGDATGGVPLSYRLLKGMGGLLFVTQEERD
FT                   TLFTVSLPRVPESSGDTKQSIDE"
     MLDSGIVLSA FCLYMACLFL IALWVERKSA AGRSPANNPF VYSLSLAVYC TAWTYYGSVG        60
     QAATSGFLFL PMYLGPTIAI MLWWSILRRL VHLRNSRRIT SIADFISARY GRSQSVAAMV       120
     TLIALVGITP YVALQLKAII STFEIITAAD ASSWIRADVG PLVVVLMVVF TIILGVRRLD       180
     PTERHEGMMM ALAVECVIKL LALLTVGIFV TYFMYDGFGD IFRRFSESPF HHVFELGRHD       240
     AGSYVTWTGY LVLSMSAILF LPRQFHVAVV ENHDEKHILT AMWLLPLYLL LVSMFVLPIA       300
     AGGLLDGRPP DQADTFVLRI PLQHGKPWLS LLVFIGGFSA AAGMIMITSV TMATMITNHL       360
     LLPLVQWIPG LAFVKRHLLK CRWGAVAGFI IIGYWFEERI GESYMLVNIG LISFAAGLQF       420
     APAILGGLFW RGGNKTGAIL GLAGGFAVWS YTLLLPSFIK SGWISNALLE KGAWGIELLK       480
     PEELFGLTGL NPLSHAVLWT MFVNIGLYVA GSLCSRERDE ERSLAEEFVG VLGTPAPLRR       540
     ARRWDAYIEL APKRSEIEKV FGQYFAEPEA TAMVEKCLFQ TGIHQAARIS IVQLVELHNE       600
     VERSLAGAIG SAAAHKALQQ GTIFTPREAQ ELSEVYGEIL ADLKVLPSEL SERIDYYQER       660
     ERLLLQQARE LEEKVNELRK QIRKRKRAQA ALRESEERYR TLVESTSDAI LMVDKDRMIV       720
     STNQAFLDLF GYERGELEGQ SIRVVHPSEE SYVVFGQRAH HAIRTGAPFR TEWNLVRKDG       780
     TILPMEGSYS AIRGPDGSPT AYVAVIRDIT ERKKAEEELK NYRDRLENMV RERTLQLEAA       840
     QKALVQREKL KTLGAIAAEV AHEIRNPLMS LGGFAMRLQK KYPESPEVEI ILEESRRLEK       900
     ILDRIKDYLR PVDIRSRECP VNTVAAECVG LLAQDLERER VVWQLDLAPE LPPALVDPDV       960
     LGEVFVHVIT HIAKVMDKQG LLTIRTYESD RNIQIDFRYR LPAHKSVQDP ERLFLPFEEG      1020
     DATGGVPLSY RLLKGMGGLL FVTQEERDTL FTVSLPRVPE SSGDTKQSID E               1071
//

If you have problems or comments...

PBIL Back to PBIL home page