(data stored in ACNUC7421 zone)

EMBL: CP000478.PE292

CP000478.PE292       Location/Qualifiers
FT   CDS             complement(355839..356081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15996"
FT                   /db_xref="GOA:A0LEZ4"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEZ4"
FT                   /protein_id="ABK15996.1"
FT                   /translation="MKRLRSVLQRSEFHTLLFVLGFALLNWPFLDIFRLKRPEVLLAYI
FT                   YILWAIGIILLFLVSRIVSKSASGDEVRKRKDHGA"
     MKRLRSVLQR SEFHTLLFVL GFALLNWPFL DIFRLKRPEV LLAYIYILWA IGIILLFLVS        60
     RIVSKSASGD EVRKRKDHGA                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page