(data stored in ACNUC7421 zone)

EMBL: CP000478.PE298

CP000478.PE298       Location/Qualifiers
FT   CDS             complement(362784..363833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0301"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: sth:STH222 2-oxoglutarate
FT                   oxidoreductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16002"
FT                   /db_xref="GOA:A0LF00"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF00"
FT                   /protein_id="ABK16002.1"
FT                   /translation="MKGNEALAEAALRAGCRYYFGYPITPQTELMEYMARRLPEIGGTF
FT                   LQAESEVAAVNMVYGAAGAGARVMTSSSGPGISLKQEGISFLASAELPCVIVNVMRGGP
FT                   GLGTIQPSQGDYFQATRGGGHGDYRVPVLAPSSVQETADLVFESFDLAEQYRTPVLLLT
FT                   DGVLGQMMEPLRLPEVRTPRTSRAPWITDGCKGRQRRIVKTLYLDPRALEAHNLHLQAK
FT                   YAQLAREEVRSEVYGIDGGMDVLIVAFGICARAARTAVDNLREKGLRAGLFRPVTLWPF
FT                   PGAALEAAALAARHVLTVELNAGQMVEDVRLALSGREIAFHGRMGGIMITASEIEAEVQ
FT                   RISEGSEAA"
     MKGNEALAEA ALRAGCRYYF GYPITPQTEL MEYMARRLPE IGGTFLQAES EVAAVNMVYG        60
     AAGAGARVMT SSSGPGISLK QEGISFLASA ELPCVIVNVM RGGPGLGTIQ PSQGDYFQAT       120
     RGGGHGDYRV PVLAPSSVQE TADLVFESFD LAEQYRTPVL LLTDGVLGQM MEPLRLPEVR       180
     TPRTSRAPWI TDGCKGRQRR IVKTLYLDPR ALEAHNLHLQ AKYAQLAREE VRSEVYGIDG       240
     GMDVLIVAFG ICARAARTAV DNLREKGLRA GLFRPVTLWP FPGAALEAAA LAARHVLTVE       300
     LNAGQMVEDV RLALSGREIA FHGRMGGIMI TASEIEAEVQ RISEGSEAA                   349
//

If you have problems or comments...

PBIL Back to PBIL home page