(data stored in ACNUC7421 zone)

EMBL: CP000478.PE299

CP000478.PE299       Location/Qualifiers
FT   CDS             complement(363833..364105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0302"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: sth:STH221 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16003"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF01"
FT                   /protein_id="ABK16003.1"
FT                   /translation="MFAARDLAFETRKRHTFKPVIHADRCKGCGICAAFCPEKILVPGS
FT                   HLNAHGYPVVKLVKGALCSGCRRCVLMCPDLAITFAHEENGSCAS"
     MFAARDLAFE TRKRHTFKPV IHADRCKGCG ICAAFCPEKI LVPGSHLNAH GYPVVKLVKG        60
     ALCSGCRRCV LMCPDLAITF AHEENGSCAS                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page