(data stored in ACNUC7421 zone)

EMBL: CP000478.PE30

CP000478.PE30        Location/Qualifiers
FT   CDS             43350..44936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0031"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: sat:SYN_00629 formate
FT                   dehydrogenase, catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15734"
FT                   /db_xref="GOA:A0LE82"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041925"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE82"
FT                   /protein_id="ABK15734.1"
FT                   /translation="MTNSFGDFARAKLILAIGTNMTEAHPVASSFVKNAVQNGGELIVV
FT                   DPRRTGLADHASQHLQLRVGSDIALLNGLMHVLITEDLYDKEYVKNCCTGFDELKKKVM
FT                   EYPPERAAEISGVDAETIRQVARKLATVRPAMLAYTLGITEHTCGMNNVLSCANLQMLL
FT                   GNVGFECGGVNPLRGQNNVQGACDMGALPNVFPGYQQVADPKARAKFEAAWNVKGLPDK
FT                   PGLMMPQMMDGLASGKVKAFYIFGENLANTEPDIRHVEHCLDSAEFLVCNDIFPTETTR
FT                   FADVVFPVAAWSENDGTFSNSERRVSRVRTVSEPPGVAKPNWWVFKEIARRMGQEWASS
FT                   SAQELWDNEISVLAPALGGIKYRRIEKDGLQWPAPTEEHPGTPTLHRDGKFTCGLGNLV
FT                   PVDWTPPAEVPDKEYPFVLSTGRRLFHYHTRTQTGRCEGLNDLLGEETADMSREDGIAM
FT                   GIQVGDKVRVKSRRGEVVVTANPTDRVPKGMVWMAFHFRDGCANWLTNPVFDPVTQTAE
FT                   YKACAVKIEKA"
     MTNSFGDFAR AKLILAIGTN MTEAHPVASS FVKNAVQNGG ELIVVDPRRT GLADHASQHL        60
     QLRVGSDIAL LNGLMHVLIT EDLYDKEYVK NCCTGFDELK KKVMEYPPER AAEISGVDAE       120
     TIRQVARKLA TVRPAMLAYT LGITEHTCGM NNVLSCANLQ MLLGNVGFEC GGVNPLRGQN       180
     NVQGACDMGA LPNVFPGYQQ VADPKARAKF EAAWNVKGLP DKPGLMMPQM MDGLASGKVK       240
     AFYIFGENLA NTEPDIRHVE HCLDSAEFLV CNDIFPTETT RFADVVFPVA AWSENDGTFS       300
     NSERRVSRVR TVSEPPGVAK PNWWVFKEIA RRMGQEWASS SAQELWDNEI SVLAPALGGI       360
     KYRRIEKDGL QWPAPTEEHP GTPTLHRDGK FTCGLGNLVP VDWTPPAEVP DKEYPFVLST       420
     GRRLFHYHTR TQTGRCEGLN DLLGEETADM SREDGIAMGI QVGDKVRVKS RRGEVVVTAN       480
     PTDRVPKGMV WMAFHFRDGC ANWLTNPVFD PVTQTAEYKA CAVKIEKA                    528
//

If you have problems or comments...

PBIL Back to PBIL home page