(data stored in ACNUC7421 zone)

EMBL: CP000478.PE301

CP000478.PE301       Location/Qualifiers
FT   CDS             366463..367569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0304"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bcn:Bcen_1312 alcohol dehydrogenase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16005"
FT                   /db_xref="GOA:A0LF03"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF03"
FT                   /protein_id="ABK16005.1"
FT                   /translation="MTIRTRAAVVRRRGGPFLFEDVEIDDPRADEALVRMVACGICHTD
FT                   IAGRDGALGVPLPAVFGHEGAGVVECVGSRVGRFRAGDKVVLSFSSCGECPGCLGGHPA
FT                   RCGEFDALNFGGARPDGSSTIRDAKGAPLGSSFFGQSSLAGYATVRERGLVGVEAVDED
FT                   ELTILAALGCGIQAGAGTVLNELKPRRGESIAIFGAGTVGLAALMAARLAGAAPIVVVD
FT                   VVASRLELALELGAAVAIDGRAGDVVEHLRETAGSIDHAVETTGVSRVIDCAMKALGSR
FT                   GNISLLAVSADEGEERVHPKSRDPGQSVIYSVAGDSDPQTFIPFLIRKHKEGAFPFERL
FT                   IRIYPASRINEAVKDSLSGITVKPVLRF"
     MTIRTRAAVV RRRGGPFLFE DVEIDDPRAD EALVRMVACG ICHTDIAGRD GALGVPLPAV        60
     FGHEGAGVVE CVGSRVGRFR AGDKVVLSFS SCGECPGCLG GHPARCGEFD ALNFGGARPD       120
     GSSTIRDAKG APLGSSFFGQ SSLAGYATVR ERGLVGVEAV DEDELTILAA LGCGIQAGAG       180
     TVLNELKPRR GESIAIFGAG TVGLAALMAA RLAGAAPIVV VDVVASRLEL ALELGAAVAI       240
     DGRAGDVVEH LRETAGSIDH AVETTGVSRV IDCAMKALGS RGNISLLAVS ADEGEERVHP       300
     KSRDPGQSVI YSVAGDSDPQ TFIPFLIRKH KEGAFPFERL IRIYPASRIN EAVKDSLSGI       360
     TVKPVLRF                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page