(data stored in ACNUC7421 zone)

EMBL: CP000478.PE302

CP000478.PE302       Location/Qualifiers
FT   CDS             367758..368117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16006"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF04"
FT                   /protein_id="ABK16006.1"
FT                   /translation="MTLKRSSWIAWCLTAAVVATCLVFGGPQTGFAQSATECDDYAKDY
FT                   ANRHTNAGADVVGGAVAGAASGALIGGIVGGGRGAGKGAAIGAGVGAVSGGAHHAGNWQ
FT                   YHYDVAYRNCMRGNR"
     MTLKRSSWIA WCLTAAVVAT CLVFGGPQTG FAQSATECDD YAKDYANRHT NAGADVVGGA        60
     VAGAASGALI GGIVGGGRGA GKGAAIGAGV GAVSGGAHHA GNWQYHYDVA YRNCMRGNR        119
//

If you have problems or comments...

PBIL Back to PBIL home page