(data stored in ACNUC7421 zone)

EMBL: CP000478.PE304

CP000478.PE304       Location/Qualifiers
FT   CDS             370587..370901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16008"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF06"
FT                   /protein_id="ABK16008.1"
FT                   /translation="MAFLVSLSCPVAENLSDNQGNTEAQGDLYRKNEQIKRELACRKIL
FT                   DDAVRFLHDLTGLCRVHLAPPTDSVRDPCSASYISSQPICKLIILSDRKTSRPESDQQV
FT                   "
     MAFLVSLSCP VAENLSDNQG NTEAQGDLYR KNEQIKRELA CRKILDDAVR FLHDLTGLCR        60
     VHLAPPTDSV RDPCSASYIS SQPICKLIIL SDRKTSRPES DQQV                        104
//

If you have problems or comments...

PBIL Back to PBIL home page