(data stored in ACNUC7421 zone)

EMBL: CP000478.PE307

CP000478.PE307       Location/Qualifiers
FT   CDS             complement(373166..373870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0310"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_2428 ABC branched-chain amino acid
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16011"
FT                   /db_xref="GOA:A0LF09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF09"
FT                   /protein_id="ABK16011.1"
FT                   /translation="MLRMENVNAGYGDVQVLWDVSFEVKAREFVVLVGANGAGKSTIMK
FT                   TISSLLHPTSGTIWFEDQRLDHVQPYHIIDVGIAHVPEARQLFPEMTVLENLEMGSLCA
FT                   RAKPHRKESIEWVLDLFPRLRERRKQLAGTLSGGEQQMCAIARGLMSKPKMLLFDEPSL
FT                   GLSPLLTQEIFRLASKIHGEGMTILMVEQNVKQTLAICDRAYVLENGRIALEGKGRELL
FT                   ENEEVKQAFLGI"
     MLRMENVNAG YGDVQVLWDV SFEVKAREFV VLVGANGAGK STIMKTISSL LHPTSGTIWF        60
     EDQRLDHVQP YHIIDVGIAH VPEARQLFPE MTVLENLEMG SLCARAKPHR KESIEWVLDL       120
     FPRLRERRKQ LAGTLSGGEQ QMCAIARGLM SKPKMLLFDE PSLGLSPLLT QEIFRLASKI       180
     HGEGMTILMV EQNVKQTLAI CDRAYVLENG RIALEGKGRE LLENEEVKQA FLGI             234
//

If you have problems or comments...

PBIL Back to PBIL home page