(data stored in ACNUC7421 zone)

EMBL: CP000478.PE31

CP000478.PE31        Location/Qualifiers
FT   CDS             45717..47351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0032"
FT                   /product="molybdopterin binding domain"
FT                   /note="PFAM: molybdopterin binding domain;
FT                   formylmethanofuran dehydrogenase, subunit E region; KEGG:
FT                   dde:Dde_0685 tungsten formylmethanofuran dehydrogenase
FT                   family protein/molybdopterin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15735"
FT                   /db_xref="GOA:A0LE83"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE83"
FT                   /protein_id="ABK15735.1"
FT                   /translation="MKIGRYSYDEYLELVKSFHGYAAPGLMMGGVMVDLALSRMPEGVL
FT                   FDAVCETASCLPDAVQLLTPCTVGNGWVRVLNLGRYALSLYDKSTGSGVRVFVDAAKIR
FT                   AWPEAEAWLFKLKPKAAQDTGLLLRQIKEAGYGIYGVQDIRIQPQFLVRHHKGSIGTCT
FT                   LCGEPYPADDGGICRGCQGEAPYAVPGEVESDGFPDGPDLLAVPVQDAVGRSMLHDMTQ
FT                   ILPGKSKGAAFRRGQQISVGDLCRLQQMGRQRVYVDQGNTPDGEWIHEDQAALAFARAM
FT                   AGEGVRFVEPPREGKINFVADRDGLFLVEEESLEEFNMVAGVMCASRRGYTLVRNGRML
FT                   GGTRAIPLYLPRSAFMKALAVLRYGPLFRVLPMRKARVGILVTGSEVFQGLIEDRFIPI
FT                   IGAKVEALDCKVVKAVIVPDDRVAIRDGVHELVRAGADLLVTTAGLSVDPDDVTRQGLK
FT                   DAGAMDMLYGAPVLPGAMTLLARIGSVQVMGVPACALYFKTTSFDLLFPRLLAGVDIAR
FT                   RDLAKLGHGSFCLECKACTFPKCPFGG"
     MKIGRYSYDE YLELVKSFHG YAAPGLMMGG VMVDLALSRM PEGVLFDAVC ETASCLPDAV        60
     QLLTPCTVGN GWVRVLNLGR YALSLYDKST GSGVRVFVDA AKIRAWPEAE AWLFKLKPKA       120
     AQDTGLLLRQ IKEAGYGIYG VQDIRIQPQF LVRHHKGSIG TCTLCGEPYP ADDGGICRGC       180
     QGEAPYAVPG EVESDGFPDG PDLLAVPVQD AVGRSMLHDM TQILPGKSKG AAFRRGQQIS       240
     VGDLCRLQQM GRQRVYVDQG NTPDGEWIHE DQAALAFARA MAGEGVRFVE PPREGKINFV       300
     ADRDGLFLVE EESLEEFNMV AGVMCASRRG YTLVRNGRML GGTRAIPLYL PRSAFMKALA       360
     VLRYGPLFRV LPMRKARVGI LVTGSEVFQG LIEDRFIPII GAKVEALDCK VVKAVIVPDD       420
     RVAIRDGVHE LVRAGADLLV TTAGLSVDPD DVTRQGLKDA GAMDMLYGAP VLPGAMTLLA       480
     RIGSVQVMGV PACALYFKTT SFDLLFPRLL AGVDIARRDL AKLGHGSFCL ECKACTFPKC       540
     PFGG                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page