(data stored in ACNUC7421 zone)

EMBL: CP000478.PE313

CP000478.PE313       Location/Qualifiers
FT   CDS             379420..380574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0316"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: mac:MA3328
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16017"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:A0LF15"
FT                   /protein_id="ABK16017.1"
FT                   /translation="MPEITRKQLLMAVISGRGPAYLRGVDLSNLDLSSAGWLAEADLRN
FT                   ADLSSANLSRSNLRNANLQQANMQNCNMAIANLEGAILQSARINVANLRAVNLAGANLR
FT                   EATLVGTTLVKANLKEANLESADLEGANLQGANLWKAKLSQANLRMTNLRGANLSEAYL
FT                   EGKLVDHYETPPKNPSQYQGFVGSVGGIQLTDLIQIVCLSRSNLMFKIESESGCGTIHV
FT                   GSGRVYHAQLDRLDGEDALFKMLAWEGGRFETVTLEEVGASTINKPVENLIIEAMRRRD
FT                   ESMPAFMRGKHGSMLREIRRYLPIPAYPSRELMKLTVAEGKNIRPTQEVQIIDAFASTD
FT                   TGEILCSIVAEEDVFIAPLRFIRIKRNHPLFDLTVNYHKEMKKT"
     MPEITRKQLL MAVISGRGPA YLRGVDLSNL DLSSAGWLAE ADLRNADLSS ANLSRSNLRN        60
     ANLQQANMQN CNMAIANLEG AILQSARINV ANLRAVNLAG ANLREATLVG TTLVKANLKE       120
     ANLESADLEG ANLQGANLWK AKLSQANLRM TNLRGANLSE AYLEGKLVDH YETPPKNPSQ       180
     YQGFVGSVGG IQLTDLIQIV CLSRSNLMFK IESESGCGTI HVGSGRVYHA QLDRLDGEDA       240
     LFKMLAWEGG RFETVTLEEV GASTINKPVE NLIIEAMRRR DESMPAFMRG KHGSMLREIR       300
     RYLPIPAYPS RELMKLTVAE GKNIRPTQEV QIIDAFASTD TGEILCSIVA EEDVFIAPLR       360
     FIRIKRNHPL FDLTVNYHKE MKKT                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page